BLASTX nr result
ID: Ophiopogon25_contig00033776
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00033776 (1051 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009381496.1| PREDICTED: exosome complex component RRP4 ho... 70 1e-09 ref|XP_021833477.1| exosome complex component RRP4 homolog [Prun... 69 2e-09 ref|XP_008234924.1| PREDICTED: exosome complex component RRP4 ho... 69 2e-09 ref|XP_007200401.1| exosome complex component RRP4 homolog [Prun... 69 2e-09 ref|XP_010070311.1| PREDICTED: exosome complex component RRP4 ho... 64 3e-09 ref|XP_010070309.1| PREDICTED: exosome complex component RRP4 ho... 64 6e-09 gb|PON52880.1| Exosome complex RNA-binding protein 1/RRP40/RRP [... 67 8e-09 ref|XP_010090344.1| exosome complex component RRP4 homolog [Moru... 67 1e-08 ref|XP_008780046.2| PREDICTED: exosome complex component RRP4 ho... 63 1e-08 ref|XP_007048187.2| PREDICTED: exosome complex component RRP4 ho... 66 2e-08 ref|XP_017417422.1| PREDICTED: exosome complex component RRP4 ho... 66 2e-08 ref|XP_020212569.1| exosome complex component RRP4 homolog [Caja... 66 2e-08 gb|PON65742.1| Exosome complex RNA-binding protein 1/RRP40/RRP [... 66 2e-08 ref|XP_022963880.1| exosome complex component RRP4 homolog isofo... 65 3e-08 ref|XP_022774877.1| exosome complex component RRP4 homolog isofo... 65 3e-08 gb|PPD76758.1| hypothetical protein GOBAR_DD26313 [Gossypium bar... 65 3e-08 ref|XP_022774876.1| exosome complex component RRP4 homolog isofo... 65 3e-08 ref|XP_009356722.1| PREDICTED: exosome complex component RRP4 ho... 65 3e-08 ref|XP_008366552.1| PREDICTED: exosome complex component RRP4 ho... 65 3e-08 ref|XP_008368883.1| PREDICTED: exosome complex component RRP4 ho... 65 3e-08 >ref|XP_009381496.1| PREDICTED: exosome complex component RRP4 homolog [Musa acuminata subsp. malaccensis] Length = 331 Score = 70.1 bits (170), Expect = 1e-09 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGTSD NGEVVAT+CGVVERVNKLVYVRAQRAR G Sbjct: 54 KGHGTSDLNGEVVATLCGVVERVNKLVYVRAQRARYKPEVG 94 >ref|XP_021833477.1| exosome complex component RRP4 homolog [Prunus avium] Length = 326 Score = 68.9 bits (167), Expect = 2e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGTS+FNGEVVATVCG+VERVNKLVYVRA RAR G Sbjct: 52 KGHGTSEFNGEVVATVCGIVERVNKLVYVRALRARYKPEVG 92 >ref|XP_008234924.1| PREDICTED: exosome complex component RRP4 homolog [Prunus mume] Length = 326 Score = 68.9 bits (167), Expect = 2e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGTS+FNGEVVATVCG+VERVNKLVYVRA RAR G Sbjct: 52 KGHGTSEFNGEVVATVCGIVERVNKLVYVRALRARYKPEVG 92 >ref|XP_007200401.1| exosome complex component RRP4 homolog [Prunus persica] gb|ONH93692.1| hypothetical protein PRUPE_8G247600 [Prunus persica] Length = 326 Score = 68.9 bits (167), Expect = 2e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGTS+FNGEVVATVCG+VERVNKLVYVRA RAR G Sbjct: 52 KGHGTSEFNGEVVATVCGIVERVNKLVYVRALRARYKPEVG 92 >ref|XP_010070311.1| PREDICTED: exosome complex component RRP4 homolog isoform X2 [Eucalyptus grandis] Length = 106 Score = 64.3 bits (155), Expect = 3e-09 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGT++ NGEVVATVCGVVERVNKLVYVR RAR G Sbjct: 52 KGHGTTELNGEVVATVCGVVERVNKLVYVRTLRARYKPEVG 92 >ref|XP_010070309.1| PREDICTED: exosome complex component RRP4 homolog isoform X1 [Eucalyptus grandis] ref|XP_010070310.1| PREDICTED: exosome complex component RRP4 homolog isoform X1 [Eucalyptus grandis] ref|XP_018716785.1| PREDICTED: exosome complex component RRP4 homolog isoform X1 [Eucalyptus grandis] Length = 134 Score = 64.3 bits (155), Expect = 6e-09 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGT++ NGEVVATVCGVVERVNKLVYVR RAR G Sbjct: 52 KGHGTTELNGEVVATVCGVVERVNKLVYVRTLRARYKPEVG 92 >gb|PON52880.1| Exosome complex RNA-binding protein 1/RRP40/RRP [Trema orientalis] Length = 333 Score = 67.4 bits (163), Expect = 8e-09 Identities = 39/85 (45%), Positives = 50/85 (58%) Frame = -3 Query: 257 LHSVQPAIHSSSDSILGDAAGFSLRS*SISVDWMNAERPIRSGPRGHGTSDFNGEVVATV 78 L S+ I+S++ + D SI V++ + S GHGTS+ NGE+VATV Sbjct: 23 LESLSSKINSNASVTVAD---------SIPVNYEDGVLKYTSRLLGHGTSELNGEIVATV 73 Query: 77 CGVVERVNKLVYVRAQRARLPQNAG 3 CG+VERVNKLVYVRA RAR G Sbjct: 74 CGIVERVNKLVYVRALRARYKPEVG 98 >ref|XP_010090344.1| exosome complex component RRP4 homolog [Morus notabilis] gb|EXB39314.1| hypothetical protein L484_025009 [Morus notabilis] Length = 331 Score = 67.0 bits (162), Expect = 1e-08 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGTS+ NGEVVATVCGVVERVNKLVYVRA RAR G Sbjct: 56 KGHGTSELNGEVVATVCGVVERVNKLVYVRALRARYKPEVG 96 >ref|XP_008780046.2| PREDICTED: exosome complex component RRP4 homolog, partial [Phoenix dactylifera] Length = 119 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGTS+ +G+VVAT+CGVVERVNKLVYVRA RAR G Sbjct: 40 KGHGTSELDGQVVATLCGVVERVNKLVYVRALRARYKPEVG 80 >ref|XP_007048187.2| PREDICTED: exosome complex component RRP4 homolog [Theobroma cacao] Length = 319 Score = 66.2 bits (160), Expect = 2e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGT+D NGE+VATVCGVVERVNKLVYVRA RAR G Sbjct: 52 KGHGTTDLNGELVATVCGVVERVNKLVYVRALRARYKPEVG 92 >ref|XP_017417422.1| PREDICTED: exosome complex component RRP4 homolog [Vigna angularis] gb|KOM38897.1| hypothetical protein LR48_Vigan03g227900 [Vigna angularis] dbj|BAT85399.1| hypothetical protein VIGAN_04294000 [Vigna angularis var. angularis] Length = 325 Score = 66.2 bits (160), Expect = 2e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGT+D NGEVVATVCGVVERVNKLVYVRA R+R G Sbjct: 52 KGHGTADLNGEVVATVCGVVERVNKLVYVRALRSRYKPEVG 92 >ref|XP_020212569.1| exosome complex component RRP4 homolog [Cajanus cajan] gb|KYP70665.1| Exosome complex exonuclease RRP4 [Cajanus cajan] Length = 331 Score = 66.2 bits (160), Expect = 2e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGT+D NGEVVATVCGVVERVNKLVYVRA R+R G Sbjct: 56 KGHGTADLNGEVVATVCGVVERVNKLVYVRALRSRYKPEVG 96 >gb|PON65742.1| Exosome complex RNA-binding protein 1/RRP40/RRP [Parasponia andersonii] Length = 327 Score = 65.9 bits (159), Expect = 2e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGTS+ NGE++ATVCG+VERVNKLVYVRA RAR G Sbjct: 52 KGHGTSELNGEIIATVCGIVERVNKLVYVRALRARYKPEVG 92 >ref|XP_022963880.1| exosome complex component RRP4 homolog isoform X2 [Cucurbita moschata] Length = 297 Score = 65.5 bits (158), Expect = 3e-08 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGT D NGEVVAT+CGVVERVNKL+YVRA RAR G Sbjct: 52 KGHGTLDLNGEVVATICGVVERVNKLIYVRALRARYKPEVG 92 >ref|XP_022774877.1| exosome complex component RRP4 homolog isoform X2 [Durio zibethinus] Length = 299 Score = 65.5 bits (158), Expect = 3e-08 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGT D NGE+VATVCGVVERVNKLVYVRA RAR G Sbjct: 52 KGHGTMDLNGELVATVCGVVERVNKLVYVRALRARYKPEVG 92 >gb|PPD76758.1| hypothetical protein GOBAR_DD26313 [Gossypium barbadense] Length = 279 Score = 65.1 bits (157), Expect = 3e-08 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGT+D NGE+VATVCGVVERVNKLVYVR+ RAR G Sbjct: 52 KGHGTTDLNGELVATVCGVVERVNKLVYVRSLRARYKPEVG 92 >ref|XP_022774876.1| exosome complex component RRP4 homolog isoform X1 [Durio zibethinus] Length = 321 Score = 65.5 bits (158), Expect = 3e-08 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGT D NGE+VATVCGVVERVNKLVYVRA RAR G Sbjct: 52 KGHGTMDLNGELVATVCGVVERVNKLVYVRALRARYKPEVG 92 >ref|XP_009356722.1| PREDICTED: exosome complex component RRP4 homolog [Pyrus x bretschneideri] Length = 324 Score = 65.5 bits (158), Expect = 3e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGTS+ NGEVVATVCGVVERVNKLVYVR+ RAR G Sbjct: 52 KGHGTSEVNGEVVATVCGVVERVNKLVYVRSLRARYKPEVG 92 >ref|XP_008366552.1| PREDICTED: exosome complex component RRP4 homolog [Malus domestica] Length = 324 Score = 65.5 bits (158), Expect = 3e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGTS+ NGEVVATVCGVVERVNKLVYVR+ RAR G Sbjct: 52 KGHGTSEVNGEVVATVCGVVERVNKLVYVRSLRARYKPEVG 92 >ref|XP_008368883.1| PREDICTED: exosome complex component RRP4 homolog isoform X1 [Malus domestica] Length = 324 Score = 65.5 bits (158), Expect = 3e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 125 RGHGTSDFNGEVVATVCGVVERVNKLVYVRAQRARLPQNAG 3 +GHGTS+ NGEVVATVCGVVERVNKLVYVR+ RAR G Sbjct: 52 KGHGTSEVNGEVVATVCGVVERVNKLVYVRSLRARYKPEVG 92