BLASTX nr result
ID: Ophiopogon25_contig00033720
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00033720 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276270.1| transcription factor bHLH30-like [Asparagus ... 55 2e-06 >ref|XP_020276270.1| transcription factor bHLH30-like [Asparagus officinalis] gb|ONK62478.1| uncharacterized protein A4U43_C07F4300 [Asparagus officinalis] Length = 243 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/43 (69%), Positives = 32/43 (74%) Frame = +1 Query: 1 LSSLRESVKDALARIASFDVVAMGASSTKRQRLLQSYYSSVSI 129 L SL ES+KDAL RI DV SS+KRQRLLQSYYSSVSI Sbjct: 201 LRSLTESLKDALGRIIEVDVGLTSVSSSKRQRLLQSYYSSVSI 243