BLASTX nr result
ID: Ophiopogon25_contig00033669
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00033669 (536 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016433387.1| PREDICTED: RING-box protein 1a isoform X1 [N... 54 7e-06 >ref|XP_016433387.1| PREDICTED: RING-box protein 1a isoform X1 [Nicotiana tabacum] Length = 134 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%), Gaps = 2/31 (6%) Frame = +2 Query: 413 NIVLLTGVCNHAFHY--ISRWLKTRQVCPLD 499 N +L GVCNHAFH+ ISRWLKTRQVCPLD Sbjct: 93 NFGILRGVCNHAFHFHCISRWLKTRQVCPLD 123