BLASTX nr result
ID: Ophiopogon25_contig00033398
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00033398 (395 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020269136.1| zinc finger CCCH domain-containing protein 4... 54 8e-06 >ref|XP_020269136.1| zinc finger CCCH domain-containing protein 45 [Asparagus officinalis] gb|ONK65709.1| uncharacterized protein A4U43_C06F130 [Asparagus officinalis] Length = 603 Score = 54.3 bits (129), Expect = 8e-06 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = -2 Query: 394 GTRSSLQSDESDNEDEVTPRRTMYGDGKKKWRESDGGEARSDKGETQ*P 248 G+RSSLQ++ES++EDE PRR+ YG+G KK R EA S++ ET P Sbjct: 550 GSRSSLQNEESESEDEAAPRRSRYGEGSKKKRWESEAEAGSEQWETPGP 598