BLASTX nr result
ID: Ophiopogon25_contig00033125
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00033125 (413 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020249063.1| uncharacterized protein LOC109826443 [Aspara... 63 2e-09 >ref|XP_020249063.1| uncharacterized protein LOC109826443 [Asparagus officinalis] Length = 175 Score = 62.8 bits (151), Expect = 2e-09 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 1/56 (1%) Frame = -1 Query: 413 ITLEDESPAKKIRTSVNNLNMRK-AVNGEVSDDEIISIGGRLKLDDSFPSKKPKIS 249 I LED +PAKK R S+N NM+K VN VSDDE I IG RLKLD++ PSKK KIS Sbjct: 114 IRLEDGNPAKKNRVSLNKTNMQKEVVNDVVSDDESICIGRRLKLDENPPSKKRKIS 169