BLASTX nr result
ID: Ophiopogon25_contig00032970
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00032970 (1259 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265714.1| uncharacterized protein LOC109841213 [Aspara... 58 7e-06 >ref|XP_020265714.1| uncharacterized protein LOC109841213 [Asparagus officinalis] gb|ONK70420.1| uncharacterized protein A4U43_C05F33550 [Asparagus officinalis] Length = 220 Score = 57.8 bits (138), Expect = 7e-06 Identities = 41/96 (42%), Positives = 49/96 (51%), Gaps = 3/96 (3%) Frame = -2 Query: 913 QRSLSILQPR---RPYITFNDNLLRLPNNELTFLWLLSSPGKTLTLASLNSPNLQP*SPF 743 QRSL +L R RPY FNDNLLR+ NNEL +L S P LQP Sbjct: 9 QRSLPLLNRRLQSRPYSAFNDNLLRILNNELAYL-------------SDYQPPLQP---- 51 Query: 742 SQKPPLRSSHSPIEDRRGDQWVRLKGQSSFKRNEDK 635 PP S S I+DR G+QW+R+K + K E K Sbjct: 52 ---PPYFRSFS-IDDRPGEQWIRMKSSNPAKNEEIK 83