BLASTX nr result
ID: Ophiopogon25_contig00032884
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00032884 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253437.1| pentatricopeptide repeat-containing protein ... 180 1e-51 ref|XP_008804180.1| PREDICTED: pentatricopeptide repeat-containi... 142 4e-37 ref|XP_010930171.1| PREDICTED: pentatricopeptide repeat-containi... 139 3e-36 ref|XP_018678453.1| PREDICTED: pentatricopeptide repeat-containi... 138 7e-36 ref|XP_020595720.1| pentatricopeptide repeat-containing protein ... 127 8e-32 ref|XP_020679948.1| pentatricopeptide repeat-containing protein ... 109 2e-25 ref|XP_020111148.1| pentatricopeptide repeat-containing protein ... 107 1e-24 gb|OAY82623.1| Pentatricopeptide repeat-containing protein [Anan... 107 1e-24 gb|POF21497.1| pentatricopeptide repeat-containing protein [Quer... 96 5e-22 ref|XP_018830858.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-21 ref|XP_023892731.1| pentatricopeptide repeat-containing protein ... 96 1e-20 ref|XP_010271746.1| PREDICTED: pentatricopeptide repeat-containi... 96 2e-20 gb|PON69935.1| Pentatricopeptide repeat [Parasponia andersonii] 94 9e-20 gb|PON88080.1| Tetratricopeptide-like helical domain containing ... 91 6e-19 gb|PRQ59999.1| putative pentatricopeptide [Rosa chinensis] 91 1e-18 ref|XP_024175887.1| pentatricopeptide repeat-containing protein ... 91 1e-18 ref|XP_010106812.1| pentatricopeptide repeat-containing protein ... 90 2e-18 ref|XP_002318245.2| hypothetical protein POPTR_0012s13730g, part... 88 1e-17 gb|PNT10964.1| hypothetical protein POPTR_012G135600v3 [Populus ... 88 1e-17 ref|XP_011030049.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 88 1e-17 >ref|XP_020253437.1| pentatricopeptide repeat-containing protein At4g38010 [Asparagus officinalis] gb|ONK77769.1| uncharacterized protein A4U43_C02F10340 [Asparagus officinalis] Length = 586 Score = 180 bits (457), Expect = 1e-51 Identities = 84/118 (71%), Positives = 99/118 (83%) Frame = -1 Query: 357 KSFNQIYSLLLTSGFTKHHLIAVEIAELLPSFNHPSFAYKALKEFHHQHKTPFLFNQLVS 178 ++ Q+YSLLLTSG TKHH IAV++AELL + N+P AYKALK+FHHQH+TPFL N L+S Sbjct: 24 RNLPQLYSLLLTSGLTKHHPIAVKLAELLLNLNNPFLAYKALKQFHHQHQTPFLLNSLIS 83 Query: 177 GFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 GFTRT NPHS++ IY M+ DGIYPDKYTFP ILKSC++FSG ESKQLHGAAIK GF Sbjct: 84 GFTRTNNPHSSILIYNLMVGDGIYPDKYTFPMILKSCARFSGFRESKQLHGAAIKMGF 141 >ref|XP_008804180.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 [Phoenix dactylifera] Length = 590 Score = 142 bits (357), Expect = 4e-37 Identities = 67/118 (56%), Positives = 87/118 (73%) Frame = -1 Query: 357 KSFNQIYSLLLTSGFTKHHLIAVEIAELLPSFNHPSFAYKALKEFHHQHKTPFLFNQLVS 178 KSFNQI++LLLTSGF K L+ + AELL HPS AYK L++ HH H PF+FN L+S Sbjct: 25 KSFNQIHALLLTSGFYKDSLVLAKFAELLALSTHPSSAYKVLRQIHH-HPIPFVFNSLIS 83 Query: 177 GFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 G+ R+K P SA ++KH++ +G D +T P +LKSC+KFSGIGE++QLHG AIK GF Sbjct: 84 GYARSKAPQSAFLLFKHLVGNGAPIDNHTLPAVLKSCTKFSGIGEARQLHGVAIKVGF 141 >ref|XP_010930171.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 [Elaeis guineensis] ref|XP_010930172.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 [Elaeis guineensis] ref|XP_019708233.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 [Elaeis guineensis] ref|XP_019708234.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 [Elaeis guineensis] Length = 598 Score = 139 bits (351), Expect = 3e-36 Identities = 66/118 (55%), Positives = 86/118 (72%) Frame = -1 Query: 357 KSFNQIYSLLLTSGFTKHHLIAVEIAELLPSFNHPSFAYKALKEFHHQHKTPFLFNQLVS 178 KSFNQI++LLLTSGF K L+ + A+LL HPS AYK L++ HH H PF+FN L+S Sbjct: 25 KSFNQIHALLLTSGFYKDSLVLAKFADLLALSTHPSSAYKVLRQIHH-HPIPFVFNSLIS 83 Query: 177 GFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 G+ R K P SA ++KH++ +G DK+T P +LKSC+KFSG GE++QLHG AIK GF Sbjct: 84 GYARIKAPRSAFLLFKHLVGNGAPLDKHTIPAVLKSCTKFSGTGEARQLHGVAIKMGF 141 >ref|XP_018678453.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 [Musa acuminata subsp. malaccensis] Length = 592 Score = 138 bits (348), Expect = 7e-36 Identities = 65/120 (54%), Positives = 88/120 (73%), Gaps = 2/120 (1%) Frame = -1 Query: 357 KSFNQIYSLLLTSGFTKHHLIAVEIAELLPSFNHPSFAYKALKEFH--HQHKTPFLFNQL 184 +SF+QI++LLLTSG TK +A E+A LLP+F P AY A+K H +++ P LFN L Sbjct: 24 RSFDQIHALLLTSGVTKDSFVAAEVAALLPAFVDPPAAYSAVKHIHGVRRYQFPLLFNSL 83 Query: 183 VSGFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 +SG+ R+K+PH + YK MLAD ++PD+YTFP +LKSC KF GIGE++QL GAA+K F Sbjct: 84 ISGYARSKHPHLGIVAYKLMLADSVFPDRYTFPIVLKSCIKFFGIGEARQLQGAAVKLRF 143 >ref|XP_020595720.1| pentatricopeptide repeat-containing protein At4g38010 [Phalaenopsis equestris] Length = 586 Score = 127 bits (319), Expect = 8e-32 Identities = 61/118 (51%), Positives = 83/118 (70%) Frame = -1 Query: 357 KSFNQIYSLLLTSGFTKHHLIAVEIAELLPSFNHPSFAYKALKEFHHQHKTPFLFNQLVS 178 +SF QI+SLLLTSGFT+ + +++A+ L SF P AY LK+ PFLFN L++ Sbjct: 23 QSFAQIHSLLLTSGFTQDLSVLLKLADFLASFQCPFLAYLTLKQTKSL-SNPFLFNSLIA 81 Query: 177 GFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 FT+ +P SA +YKH++ DGI PDKYTFP +LKSC+KFSGI E++Q+H + K GF Sbjct: 82 SFTQNGSPQSAFAVYKHLVCDGISPDKYTFPLVLKSCAKFSGINEARQIHAVSTKLGF 139 >ref|XP_020679948.1| pentatricopeptide repeat-containing protein At4g38010 [Dendrobium catenatum] gb|PKU84293.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 587 Score = 109 bits (273), Expect = 2e-25 Identities = 55/116 (47%), Positives = 78/116 (67%) Frame = -1 Query: 351 FNQIYSLLLTSGFTKHHLIAVEIAELLPSFNHPSFAYKALKEFHHQHKTPFLFNQLVSGF 172 F Q++ LLLTSG T+ + + +AE L S PS AY LK+ + PF+FN L++ F Sbjct: 25 FAQVHCLLLTSGVTQDFSVLLMLAEFLASSQSPSSAYFTLKQTL-RFPNPFIFNSLITVF 83 Query: 171 TRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 T+T +P SA +YK+++ DG DK T+P +LKSC+KFSGI E++Q+H AA K GF Sbjct: 84 TQTSSPQSAFVVYKYLVCDGFSQDKSTYPLVLKSCAKFSGIKEARQIHVAATKLGF 139 >ref|XP_020111148.1| pentatricopeptide repeat-containing protein At4g38010 [Ananas comosus] Length = 593 Score = 107 bits (267), Expect = 1e-24 Identities = 53/119 (44%), Positives = 76/119 (63%), Gaps = 3/119 (2%) Frame = -1 Query: 351 FNQIYSLLLTSGFTKHHLIAVEIAELLP--SFNHPSFAYKALKEFHH-QHKTPFLFNQLV 181 F ++ +L+LTSGF + I + A+ L SF+ S +YK L + H H +PF FN L+ Sbjct: 31 FPELQALILTSGFAQDPSILLPFAQYLANFSFSSSSSSYKTLLQIRHLHHPSPFPFNSLI 90 Query: 180 SGFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 + + T+ P +A+ +Y M DGI PD+YT P LKSC++F G+GE +QLH AAIK GF Sbjct: 91 ASYAHTRRPQAALAVYTSMARDGIRPDRYTLPVALKSCARFLGLGEGRQLHCAAIKMGF 149 >gb|OAY82623.1| Pentatricopeptide repeat-containing protein [Ananas comosus] Length = 593 Score = 107 bits (267), Expect = 1e-24 Identities = 53/119 (44%), Positives = 76/119 (63%), Gaps = 3/119 (2%) Frame = -1 Query: 351 FNQIYSLLLTSGFTKHHLIAVEIAELLP--SFNHPSFAYKALKEFHH-QHKTPFLFNQLV 181 F ++ +L+LTSGF + I + A+ L SF+ S +YK L + H H +PF FN L+ Sbjct: 31 FPELQALILTSGFAQDPSILLPFAQYLANFSFSSSSSSYKTLLQIRHLHHPSPFPFNSLI 90 Query: 180 SGFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 + + T+ P +A+ +Y M DGI PD+YT P LKSC++F G+GE +QLH AAIK GF Sbjct: 91 ASYAHTRRPQAALAVYTSMARDGIRPDRYTLPVALKSCARFLGLGEGRQLHCAAIKMGF 149 >gb|POF21497.1| pentatricopeptide repeat-containing protein [Quercus suber] Length = 237 Score = 96.3 bits (238), Expect = 5e-22 Identities = 48/119 (40%), Positives = 72/119 (60%), Gaps = 1/119 (0%) Frame = -1 Query: 357 KSFNQIYSLLLTSGFTKHHLIAVEIAELLPSF-NHPSFAYKALKEFHHQHKTPFLFNQLV 181 + F QI++ LLTSG + L+ ++AE F + + LK+ + F N L+ Sbjct: 23 RPFKQIHAQLLTSGIVRDELVVNKVAEFFGKFVEYVEYGCDLLKQIDWCTSS-FPCNLLI 81 Query: 180 SGFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 + + + P +AV IY+ ++ DG PDKYTFP +LKSC+KFSG GE +Q+HG +KTGF Sbjct: 82 TSYAGSDMPEAAVLIYRRIVRDGFMPDKYTFPVVLKSCTKFSGSGEGRQIHGVVVKTGF 140 >ref|XP_018830858.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 [Juglans regia] ref|XP_018830859.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 [Juglans regia] ref|XP_018830860.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 [Juglans regia] ref|XP_018830861.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 [Juglans regia] ref|XP_018830862.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 [Juglans regia] Length = 594 Score = 99.0 bits (245), Expect = 1e-21 Identities = 48/119 (40%), Positives = 72/119 (60%), Gaps = 1/119 (0%) Frame = -1 Query: 357 KSFNQIYSLLLTSGFTKHHLIAVEIAELLPSF-NHPSFAYKALKEFHHQHKTPFLFNQLV 181 +SF QI++ LLTSG + L+ +AE F N + LK+ + F +N ++ Sbjct: 23 RSFMQIHAQLLTSGVVRDQLVVNRVAEFFGKFANFSEYGCDLLKQIDWSISS-FPYNLMI 81 Query: 180 SGFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 SG+ + P +AV +Y+ M+ +G PD YTFP +LKSC+KF GIGE +Q+HG +K GF Sbjct: 82 SGYAGSDTPRAAVLVYRRMMRNGFMPDMYTFPVVLKSCAKFLGIGEGRQVHGVVVKMGF 140 >ref|XP_023892731.1| pentatricopeptide repeat-containing protein At4g38010 [Quercus suber] Length = 597 Score = 96.3 bits (238), Expect = 1e-20 Identities = 48/119 (40%), Positives = 72/119 (60%), Gaps = 1/119 (0%) Frame = -1 Query: 357 KSFNQIYSLLLTSGFTKHHLIAVEIAELLPSF-NHPSFAYKALKEFHHQHKTPFLFNQLV 181 + F QI++ LLTSG + L+ ++AE F + + LK+ + F N L+ Sbjct: 23 RPFKQIHAQLLTSGIVRDELVVNKVAEFFGKFVEYVEYGCDLLKQIDWCTSS-FPCNLLI 81 Query: 180 SGFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 + + + P +AV IY+ ++ DG PDKYTFP +LKSC+KFSG GE +Q+HG +KTGF Sbjct: 82 TSYAGSDMPEAAVLIYRRIVRDGFMPDKYTFPVVLKSCTKFSGSGEGRQIHGVVVKTGF 140 >ref|XP_010271746.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 [Nelumbo nucifera] Length = 605 Score = 95.5 bits (236), Expect = 2e-20 Identities = 49/120 (40%), Positives = 73/120 (60%), Gaps = 2/120 (1%) Frame = -1 Query: 357 KSFNQIYSLLLTSGFTK--HHLIAVEIAELLPSFNHPSFAYKALKEFHHQHKTPFLFNQL 184 KSFNQI+S L+TSG + + L+ + S+ +A + L + H+ H++ F FN L Sbjct: 23 KSFNQIHSQLVTSGIIQDGNVLVLGKSIAFFASYADFEYACEFLNQIHY-HRSSFAFNSL 81 Query: 183 VSGFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 VS + + P +A+ +Y+ ++ +G PD YTFP +LKSCSK GI E KQ+HG K GF Sbjct: 82 VSAYAVSNKPQAAILVYRKIVRNGFLPDMYTFPVVLKSCSKVLGIVEGKQVHGVVAKMGF 141 >gb|PON69935.1| Pentatricopeptide repeat [Parasponia andersonii] Length = 594 Score = 93.6 bits (231), Expect = 9e-20 Identities = 49/119 (41%), Positives = 72/119 (60%), Gaps = 1/119 (0%) Frame = -1 Query: 357 KSFNQIYSLLLTSGFTKHHLIAVEIAELL-PSFNHPSFAYKALKEFHHQHKTPFLFNQLV 181 ++FNQI++ LLT+G + LIA + E S ++A LK + + F FN L+ Sbjct: 19 RTFNQIHAHLLTTGLVYNDLIAKTVVEYFGKSVGVINYACNFLKHLDWRSSS-FPFNTLI 77 Query: 180 SGFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 SG+ + P +AV +Y+ ++ DG PD +TFP LKSC+KF GIGE +Q+HG K GF Sbjct: 78 SGYAASDLPRAAVLVYRRIVRDGFMPDMFTFPAFLKSCTKFLGIGEGRQVHGVIFKMGF 136 >gb|PON88080.1| Tetratricopeptide-like helical domain containing protein [Trema orientalis] Length = 594 Score = 91.3 bits (225), Expect = 6e-19 Identities = 48/118 (40%), Positives = 71/118 (60%), Gaps = 1/118 (0%) Frame = -1 Query: 357 KSFNQIYSLLLTSGFTKHHLIAVEIAELL-PSFNHPSFAYKALKEFHHQHKTPFLFNQLV 181 ++FNQI++ LLT+G + LIA + E S +A LK + + F FN L+ Sbjct: 19 RTFNQIHAHLLTTGLVYNDLIAKTVVEYFGKSVGVIDYACDFLKHLAWRSSS-FPFNTLI 77 Query: 180 SGFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTG 7 SG+ + P +AV +Y+ ++ DG PD +TFP +LKSC+KF GIGE +Q+HG K G Sbjct: 78 SGYAASAMPRAAVLVYRRVVRDGFMPDVFTFPAVLKSCTKFLGIGEGRQVHGVIFKMG 135 >gb|PRQ59999.1| putative pentatricopeptide [Rosa chinensis] Length = 625 Score = 90.5 bits (223), Expect = 1e-18 Identities = 45/118 (38%), Positives = 69/118 (58%), Gaps = 1/118 (0%) Frame = -1 Query: 351 FNQIYSLLLTSGFTKHHLIAVEIAELL-PSFNHPSFAYKALKEFHHQHKTPFLFNQLVSG 175 F QI++ +TSG + L+A + L S H +A LK+ + + F FN L+SG Sbjct: 63 FKQIHAKTVTSGLACNELVATNVVNFLGKSVTHFDYACDFLKQVDWRVNS-FPFNMLISG 121 Query: 174 FTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGFE 1 + +N AV +Y+ ++ DG PD +T P +LKSC KF G+GE +Q+HG +K GF+ Sbjct: 122 YANGENAGEAVLVYRRIVRDGFMPDMFTIPAVLKSCVKFLGMGEGRQVHGVVVKMGFQ 179 >ref|XP_024175887.1| pentatricopeptide repeat-containing protein At4g38010 [Rosa chinensis] Length = 702 Score = 90.5 bits (223), Expect = 1e-18 Identities = 45/118 (38%), Positives = 69/118 (58%), Gaps = 1/118 (0%) Frame = -1 Query: 351 FNQIYSLLLTSGFTKHHLIAVEIAELL-PSFNHPSFAYKALKEFHHQHKTPFLFNQLVSG 175 F QI++ +TSG + L+A + L S H +A LK+ + + F FN L+SG Sbjct: 140 FKQIHAKTVTSGLACNELVATNVVNFLGKSVTHFDYACDFLKQVDWRVNS-FPFNMLISG 198 Query: 174 FTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGFE 1 + +N AV +Y+ ++ DG PD +T P +LKSC KF G+GE +Q+HG +K GF+ Sbjct: 199 YANGENAGEAVLVYRRIVRDGFMPDMFTIPAVLKSCVKFLGMGEGRQVHGVVVKMGFQ 256 >ref|XP_010106812.1| pentatricopeptide repeat-containing protein At4g38010 [Morus notabilis] gb|EXC11897.1| hypothetical protein L484_005358 [Morus notabilis] Length = 584 Score = 89.7 bits (221), Expect = 2e-18 Identities = 46/120 (38%), Positives = 72/120 (60%), Gaps = 2/120 (1%) Frame = -1 Query: 357 KSFNQIYSLLLTSGFTKHHLIAVEIAELL--PSFNHPSFAYKALKEFHHQHKTPFLFNQL 184 +SF QI++ LLT+G + LI + E PS + +A LK + + F FN + Sbjct: 19 RSFKQIHAYLLTTGLVYNDLIVNSVVEYFGRPSASVVDYACDFLKHLDWRSNS-FPFNTM 77 Query: 183 VSGFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 +SG+T ++ P +AV +Y+ ++ DG PD +TFP +LKSC+KF GI E +Q+H + GF Sbjct: 78 ISGYTGSEMPKAAVLVYRRIVRDGFMPDTFTFPAVLKSCTKFLGIREGRQVHSVIVVMGF 137 >ref|XP_002318245.2| hypothetical protein POPTR_0012s13730g, partial [Populus trichocarpa] Length = 602 Score = 87.8 bits (216), Expect = 1e-17 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 1/118 (0%) Frame = -1 Query: 354 SFNQIYSLLLTSGFTKHHLIAVEIAELLPSF-NHPSFAYKALKEFHHQHKTPFLFNQLVS 178 +F +I++ L+TSG + + + E N +A L E+ + + F FN LVS Sbjct: 24 TFKKIHAQLITSGVVSNDFVVNRVVEFFAKGPNFVDYACDFLSEYDWKVSS-FPFNALVS 82 Query: 177 GFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 G+ P +A +Y+ ++ DG PD +TFP +LKSC+KF GIGE +Q+HG IK GF Sbjct: 83 GYAIGDRPKTAFLVYRRIVKDGFLPDMFTFPAVLKSCAKFVGIGEGRQVHGVIIKMGF 140 >gb|PNT10964.1| hypothetical protein POPTR_012G135600v3 [Populus trichocarpa] Length = 604 Score = 87.8 bits (216), Expect = 1e-17 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 1/118 (0%) Frame = -1 Query: 354 SFNQIYSLLLTSGFTKHHLIAVEIAELLPSF-NHPSFAYKALKEFHHQHKTPFLFNQLVS 178 +F +I++ L+TSG + + + E N +A L E+ + + F FN LVS Sbjct: 24 TFKKIHAQLITSGVVSNDFVVNRVVEFFAKGPNFVDYACDFLSEYDWKVSS-FPFNALVS 82 Query: 177 GFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 G+ P +A +Y+ ++ DG PD +TFP +LKSC+KF GIGE +Q+HG IK GF Sbjct: 83 GYAIGDRPKTAFLVYRRIVKDGFLPDMFTFPAVLKSCAKFVGIGEGRQVHGVIIKMGF 140 >ref|XP_011030049.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g38010-like [Populus euphratica] Length = 622 Score = 87.8 bits (216), Expect = 1e-17 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 1/118 (0%) Frame = -1 Query: 354 SFNQIYSLLLTSGFTKHHLIAVEIAELLPSF-NHPSFAYKALKEFHHQHKTPFLFNQLVS 178 +F +I++ L+TSG + + + E N +A L E+ + + F FN LVS Sbjct: 24 TFKKIHAQLITSGVVSNDFVVNRVVEFFAKGPNFVDYACDFLNEYDWKVSS-FPFNALVS 82 Query: 177 GFTRTKNPHSAVEIYKHMLADGIYPDKYTFPTILKSCSKFSGIGESKQLHGAAIKTGF 4 G+ P +A +Y+ ++ DG PD +TFP +LKSC+KF GIGE +Q+HG IK GF Sbjct: 83 GYAIGDRPKTAFLVYRRIVKDGFLPDMFTFPAVLKSCAKFVGIGEGRQVHGVIIKMGF 140