BLASTX nr result
ID: Ophiopogon25_contig00032758
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00032758 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266027.1| putative pentatricopeptide repeat-containing... 61 2e-08 >ref|XP_020266027.1| putative pentatricopeptide repeat-containing protein At5g59900, partial [Asparagus officinalis] Length = 891 Score = 60.8 bits (146), Expect(2) = 2e-08 Identities = 32/51 (62%), Positives = 37/51 (72%) Frame = -2 Query: 204 LAFHHSNLSF*ILV*TLIKSNLHWAILSLPQTLISSQITPLEVFESLTKSQ 52 L F+HS LSF IL+ +LI SNLHW SL QTLIS +TP E FESL KS+ Sbjct: 74 LRFNHSALSFSILIHSLIGSNLHWPACSLAQTLISRPVTPREAFESLWKSR 124 Score = 25.4 bits (54), Expect(2) = 2e-08 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -1 Query: 235 PRLSLNFFNYFGL 197 PRL L FFNY GL Sbjct: 60 PRLPLRFFNYLGL 72