BLASTX nr result
ID: Ophiopogon25_contig00032504
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00032504 (487 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242889.1| uncharacterized protein LOC109821106 [Aspara... 54 8e-06 >ref|XP_020242889.1| uncharacterized protein LOC109821106 [Asparagus officinalis] Length = 186 Score = 53.9 bits (128), Expect = 8e-06 Identities = 18/46 (39%), Positives = 35/46 (76%) Frame = -2 Query: 369 RVEWDLYVMAVIWIVWGERNDRIFHNKKRNGMSILSSIHSYVSFWL 232 +++ D+++ +++W VW ERNDR+F NK++ + +L+ I ++ SFWL Sbjct: 96 KMKRDVFICSLVWCVWQERNDRLFSNKRKRSLELLNKIMTFSSFWL 141