BLASTX nr result
ID: Ophiopogon25_contig00031456
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00031456 (616 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009068825.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 57 6e-06 >ref|XP_009068825.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G [Acanthisitta chloris] Length = 753 Score = 57.0 bits (136), Expect = 6e-06 Identities = 42/138 (30%), Positives = 71/138 (51%), Gaps = 1/138 (0%) Frame = +3 Query: 69 KNNSRTKIKNTIKDAESKLSPPTDHQSTRFRSKK*NQNKG-EKSKKLVTKEKNKQKKNLS 245 K++S+++ K+ K+ +SK S D + R RSK+ + KG EK K+ ++ ++K++ Sbjct: 456 KSHSKSREKSKSKERDSKHSRH-DEKRARSRSKERDHEKGREKEKRYDSRGRDKERSRSK 514 Query: 246 ETKN*TRSKMEEKIWSQHSRSKENQCRSSRSRLQRDQIEPEHNLIHPRRKRPPGTDRTNS 425 E S+ E+ +H +SKE + R SRSR +R+ +H+ R R DR+ Sbjct: 515 ERSKRAGSRSTEQ---EHRKSKEREKRKSRSR-EREHARGKHSSSSRTRDRSKSRDRSRR 570 Query: 426 TRDLDGHRERERGASDSR 479 R R+R R SR Sbjct: 571 GRSRSRDRDRSRSKDYSR 588