BLASTX nr result
ID: Ophiopogon25_contig00031202
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00031202 (527 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLW42976.1| hypothetical protein PCASD_04726 [Puccinia corona... 57 2e-06 >gb|PLW42976.1| hypothetical protein PCASD_04726 [Puccinia coronata var. avenae f. sp. avenae] Length = 429 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +3 Query: 315 VWNHFDLVTTDGVRKAVCKYCNKQFNHAEGYGTGDLSRHYDRKHAKDHGL-PDKQAQILA 491 VW+HF+ + DG+ KAVC YC Q A GT L RH D+ K G+ +Q+QI Sbjct: 71 VWDHFEKIIQDGIAKAVCNYCQTQLAGASSTGTTHLKRHADKCIVKHGGIGSSRQSQIDF 130 Query: 492 DSGTLSTW 515 SG+ + W Sbjct: 131 RSGSQAVW 138