BLASTX nr result
ID: Ophiopogon25_contig00031052
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00031052 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA09618.1| hypothetical protein SOVF_152080 [Spinacia oleracea] 60 3e-08 ref|XP_021847437.1| calcium uniporter protein 6, mitochondrial-l... 60 5e-08 ref|XP_020250208.1| calcium uniporter protein 6, mitochondrial-l... 59 7e-08 gb|PNX94078.1| hypothetical protein L195_g017245 [Trifolium prat... 59 2e-07 ref|XP_021761836.1| calcium uniporter protein 6, mitochondrial-l... 59 2e-07 ref|XP_012835356.1| PREDICTED: calcium uniporter protein 6, mito... 59 2e-07 gb|ERN04321.1| hypothetical protein AMTR_s00077p00191360 [Ambore... 59 2e-07 ref|XP_011622713.1| calcium uniporter protein 6, mitochondrial [... 59 2e-07 ref|XP_004490741.1| PREDICTED: calcium uniporter protein 5, mito... 59 2e-07 ref|XP_019098668.1| PREDICTED: calcium uniporter protein 5, mito... 56 3e-07 ref|XP_016196253.1| uncharacterized protein LOC107637248 isoform... 58 3e-07 gb|PNX54369.1| hypothetical protein L195_g047987 [Trifolium prat... 57 3e-07 gb|PNX85748.1| hypothetical protein L195_g041822, partial [Trifo... 57 3e-07 gb|PIN14657.1| hypothetical protein CDL12_12714 [Handroanthus im... 58 4e-07 gb|POE57535.1| calcium uniporter protein 5, mitochondrial [Querc... 57 4e-07 ref|XP_013460510.1| transmembrane protein, putative [Medicago tr... 58 4e-07 ref|XP_011080607.1| calcium uniporter protein 5, mitochondrial-l... 55 4e-07 ref|XP_022847100.1| calcium uniporter protein 5, mitochondrial-l... 57 5e-07 gb|PKA60297.1| hypothetical protein AXF42_Ash008356 [Apostasia s... 57 5e-07 ref|XP_002526387.1| PREDICTED: calcium uniporter protein 6, mito... 57 5e-07 >gb|KNA09618.1| hypothetical protein SOVF_152080 [Spinacia oleracea] Length = 219 Score = 60.1 bits (144), Expect = 3e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 265 DEAAAFSKVLDDAGVILLFRDKVYLHPDKEPE 360 DEAAAF+KVLDDAGV+LLFRDKVYLHPDK E Sbjct: 40 DEAAAFAKVLDDAGVVLLFRDKVYLHPDKVVE 71 >ref|XP_021847437.1| calcium uniporter protein 6, mitochondrial-like [Spinacia oleracea] Length = 289 Score = 60.1 bits (144), Expect = 5e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 265 DEAAAFSKVLDDAGVILLFRDKVYLHPDKEPE 360 DEAAAF+KVLDDAGV+LLFRDKVYLHPDK E Sbjct: 110 DEAAAFAKVLDDAGVVLLFRDKVYLHPDKVVE 141 >ref|XP_020250208.1| calcium uniporter protein 6, mitochondrial-like [Asparagus officinalis] gb|ONK55257.1| uncharacterized protein A4U43_UnF5810 [Asparagus officinalis] Length = 248 Score = 59.3 bits (142), Expect = 7e-08 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 7/44 (15%) Frame = +1 Query: 250 EACHG-------DEAAAFSKVLDDAGVILLFRDKVYLHPDKEPE 360 EAC G +EAAAF++VLDDAGV+LLFRDKVYLHPDK E Sbjct: 53 EACEGMGVARTKEEAAAFARVLDDAGVLLLFRDKVYLHPDKVVE 96 >gb|PNX94078.1| hypothetical protein L195_g017245 [Trifolium pratense] Length = 269 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/52 (61%), Positives = 38/52 (73%), Gaps = 8/52 (15%) Frame = +1 Query: 220 GLDVVLGGE-AEAC-------HGDEAAAFSKVLDDAGVILLFRDKVYLHPDK 351 G +V+ E EAC + DEA+AF+KVLD+AGVILLFRDKVYLHPDK Sbjct: 57 GKEVIAYSELVEACESMGVARNSDEASAFAKVLDEAGVILLFRDKVYLHPDK 108 >ref|XP_021761836.1| calcium uniporter protein 6, mitochondrial-like [Chenopodium quinoa] Length = 284 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 265 DEAAAFSKVLDDAGVILLFRDKVYLHPDKEPE 360 DEAAAF+KVLD+AGV+LLFRDKVYLHPDK E Sbjct: 107 DEAAAFAKVLDEAGVVLLFRDKVYLHPDKVVE 138 >ref|XP_012835356.1| PREDICTED: calcium uniporter protein 6, mitochondrial-like [Erythranthe guttata] Length = 287 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +1 Query: 265 DEAAAFSKVLDDAGVILLFRDKVYLHPDK 351 DEAAAF++VLDDAGV+LLFRDKVYLHPDK Sbjct: 105 DEAAAFARVLDDAGVVLLFRDKVYLHPDK 133 >gb|ERN04321.1| hypothetical protein AMTR_s00077p00191360 [Amborella trichopoda] Length = 311 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 265 DEAAAFSKVLDDAGVILLFRDKVYLHPDK 351 DEAAAF+KVLD+AGVILLFRDKVYLHPDK Sbjct: 133 DEAAAFAKVLDEAGVILLFRDKVYLHPDK 161 >ref|XP_011622713.1| calcium uniporter protein 6, mitochondrial [Amborella trichopoda] Length = 312 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 265 DEAAAFSKVLDDAGVILLFRDKVYLHPDK 351 DEAAAF+KVLD+AGVILLFRDKVYLHPDK Sbjct: 134 DEAAAFAKVLDEAGVILLFRDKVYLHPDK 162 >ref|XP_004490741.1| PREDICTED: calcium uniporter protein 5, mitochondrial-like [Cicer arietinum] Length = 350 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/52 (61%), Positives = 38/52 (73%), Gaps = 8/52 (15%) Frame = +1 Query: 220 GLDVVLGGE-AEAC-------HGDEAAAFSKVLDDAGVILLFRDKVYLHPDK 351 G +V+ E EAC + DEA+AF+KVLD+AGVILLFRDKVYLHPDK Sbjct: 138 GKEVIAYSELVEACESMGVARNSDEASAFAKVLDEAGVILLFRDKVYLHPDK 189 >ref|XP_019098668.1| PREDICTED: calcium uniporter protein 5, mitochondrial-like, partial [Camelina sativa] Length = 124 Score = 55.8 bits (133), Expect = 3e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 265 DEAAAFSKVLDDAGVILLFRDKVYLHPDK 351 DEA AF++VLDDAGVIL+FRDKVYLHPDK Sbjct: 96 DEAHAFARVLDDAGVILIFRDKVYLHPDK 124 >ref|XP_016196253.1| uncharacterized protein LOC107637248 isoform X2 [Arachis ipaensis] Length = 294 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 265 DEAAAFSKVLDDAGVILLFRDKVYLHPDKE 354 +EA AFSKVLD+AGVILLFRDKVYLHPDKE Sbjct: 163 EEAIAFSKVLDEAGVILLFRDKVYLHPDKE 192 >gb|PNX54369.1| hypothetical protein L195_g047987 [Trifolium pratense] Length = 182 Score = 57.0 bits (136), Expect = 3e-07 Identities = 29/41 (70%), Positives = 32/41 (78%), Gaps = 4/41 (9%) Frame = +1 Query: 265 DEAAAFSKVLDDAGVILLFRDKVYLHPDK----EPECKYEA 375 DEAA F+KVLD+AGV+LLFRDKVYLHPDK PE EA Sbjct: 139 DEAATFAKVLDEAGVVLLFRDKVYLHPDKGGPDNPEFGLEA 179 >gb|PNX85748.1| hypothetical protein L195_g041822, partial [Trifolium pratense] Length = 167 Score = 56.6 bits (135), Expect = 3e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 265 DEAAAFSKVLDDAGVILLFRDKVYLHPDK 351 DEAA F+KVLD+AGV+LLFRDKVYLHPDK Sbjct: 139 DEAATFAKVLDEAGVVLLFRDKVYLHPDK 167 >gb|PIN14657.1| hypothetical protein CDL12_12714 [Handroanthus impetiginosus] Length = 297 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 262 GDEAAAFSKVLDDAGVILLFRDKVYLHPDK 351 GDEA AF++VLD+AGV+LLFRDKVYLHPDK Sbjct: 107 GDEATAFARVLDEAGVVLLFRDKVYLHPDK 136 >gb|POE57535.1| calcium uniporter protein 5, mitochondrial [Quercus suber] Length = 210 Score = 57.0 bits (136), Expect = 4e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +1 Query: 265 DEAAAFSKVLDDAGVILLFRDKVYLHPDK 351 DEAAAF++VLD+AGVILLFRDKVYLHPDK Sbjct: 146 DEAAAFAQVLDEAGVILLFRDKVYLHPDK 174 >ref|XP_013460510.1| transmembrane protein, putative [Medicago truncatula] gb|KEH34544.1| transmembrane protein, putative [Medicago truncatula] Length = 340 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 265 DEAAAFSKVLDDAGVILLFRDKVYLHPDK 351 DEAA F+KVLDDAGV+LLFRDKVYLHPDK Sbjct: 151 DEAAKFAKVLDDAGVVLLFRDKVYLHPDK 179 >ref|XP_011080607.1| calcium uniporter protein 5, mitochondrial-like [Sesamum indicum] Length = 311 Score = 55.5 bits (132), Expect(2) = 4e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +1 Query: 253 ACHGDEAAAFSKVLDDAGVILLFRDKVYLHPDK 351 A DEAAA+++VLDDAGV++LFRDKVYLHP+K Sbjct: 107 ATSADEAAAYARVLDDAGVVMLFRDKVYLHPNK 139 Score = 26.2 bits (56), Expect(2) = 4e-07 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +2 Query: 113 CRLPAEHPILPWAHHHFCSATAXXXXXXXXXRSNSKDSMSFSEAKRKLAM 262 CRL P H +CS+ A ++ S SMS+ EAKR + + Sbjct: 31 CRLMGSSPF-----HRYCSS-AVAGDGGSESKNGSASSMSYGEAKRLMRL 74 >ref|XP_022847100.1| calcium uniporter protein 5, mitochondrial-like [Olea europaea var. sylvestris] Length = 298 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +1 Query: 265 DEAAAFSKVLDDAGVILLFRDKVYLHPDK 351 DEAAAF++VLD+AGVILLFRDKVYLHPDK Sbjct: 109 DEAAAFARVLDEAGVILLFRDKVYLHPDK 137 >gb|PKA60297.1| hypothetical protein AXF42_Ash008356 [Apostasia shenzhenica] Length = 303 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 7/41 (17%) Frame = +1 Query: 250 EACHG-------DEAAAFSKVLDDAGVILLFRDKVYLHPDK 351 EAC G +EA AF++VLDDAGV+LLFRDKVYLHPDK Sbjct: 110 EACEGMGVARTKEEAEAFARVLDDAGVVLLFRDKVYLHPDK 150 >ref|XP_002526387.1| PREDICTED: calcium uniporter protein 6, mitochondrial [Ricinus communis] gb|EEF35963.1| conserved hypothetical protein [Ricinus communis] Length = 313 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 265 DEAAAFSKVLDDAGVILLFRDKVYLHPDKEPE 360 DEAAAF++VLD+AGV+LLFRDKVYLHPDK E Sbjct: 124 DEAAAFARVLDEAGVVLLFRDKVYLHPDKVVE 155