BLASTX nr result
ID: Ophiopogon25_contig00030749
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00030749 (1034 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX72145.1| hypothetical protein RirG_072160 [Rhizophagus irr... 119 3e-28 >gb|EXX72145.1| hypothetical protein RirG_072160 [Rhizophagus irregularis DAOM 197198w] dbj|GBC40159.1| hypothetical protein RIR_2377500 [Rhizophagus irregularis DAOM 181602] gb|PKC11193.1| hypothetical protein RhiirA5_468496 [Rhizophagus irregularis] gb|PKC74050.1| hypothetical protein RhiirA1_450432 [Rhizophagus irregularis] gb|PKY17736.1| hypothetical protein RhiirB3_382761 [Rhizophagus irregularis] gb|PKY45928.1| hypothetical protein RhiirA4_179160 [Rhizophagus irregularis] gb|POG81662.1| hypothetical protein GLOIN_2v1762899 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 230 Score = 119 bits (298), Expect = 3e-28 Identities = 63/68 (92%), Positives = 63/68 (92%) Frame = -1 Query: 1010 RPISLQNEFQFKVKRKPTLTPISSPVQQQQNSRQLPSSTLNPVVDPMTEIVAALKMPIDG 831 RPISLQNE FKVKRKPTLTPISSPVQQQ RQLPSSTLNPVVDPMTEIVAALKMPIDG Sbjct: 166 RPISLQNESLFKVKRKPTLTPISSPVQQQ---RQLPSSTLNPVVDPMTEIVAALKMPIDG 222 Query: 830 NFDQKLVV 807 NFDQKLVV Sbjct: 223 NFDQKLVV 230