BLASTX nr result
ID: Ophiopogon25_contig00030678
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00030678 (615 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241568.1| kinesin-like protein KIN-7L [Asparagus offic... 62 2e-07 >ref|XP_020241568.1| kinesin-like protein KIN-7L [Asparagus officinalis] gb|ONK60319.1| uncharacterized protein A4U43_C08F16960 [Asparagus officinalis] Length = 664 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = +1 Query: 187 ECENLAIEVNEERKSHEALEQCLKEQQMKIESIRKLSVSMDQPDSSSQ 330 E E LA+E+ EERKS EALE+CLKEQQMKIES LS+S DQ + ++Q Sbjct: 388 EREKLAMELEEERKSREALERCLKEQQMKIESFSTLSLSTDQVNGTTQ 435