BLASTX nr result
ID: Ophiopogon25_contig00030642
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00030642 (668 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242303.1| uncharacterized protein LOC109820554 [Aspara... 62 1e-07 >ref|XP_020242303.1| uncharacterized protein LOC109820554 [Asparagus officinalis] gb|ONK61359.1| uncharacterized protein A4U43_C08F29060 [Asparagus officinalis] Length = 435 Score = 62.0 bits (149), Expect = 1e-07 Identities = 45/119 (37%), Positives = 54/119 (45%), Gaps = 5/119 (4%) Frame = -3 Query: 408 MICVGASVPTTRILHHQLIQEKNHNPNQSPKXXXXXXXXXXXXXXXXXXXXAVDMESPSR 229 MIC+GAS+P+ RILHHQ IQ+K H A++MES S+ Sbjct: 1 MICIGASIPSARILHHQQIQDKEH-------ILRSKSSYLRSPATTTVRIPAIEMESTSK 53 Query: 228 -----SQPLILTSGASGRVTAXXXXXXXXXXXXXXXXXXXXXXXXXXXRTVIVSEKSDG 67 S PLILTSGASGRVTA RT+ VSEKS+G Sbjct: 54 ASAIASTPLILTSGASGRVTALFSLRSLRSLLLLFNSFLLLLLLPFRRRTIAVSEKSEG 112