BLASTX nr result
ID: Ophiopogon25_contig00030371
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00030371 (509 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020240946.1| probable receptor-like protein kinase At4g10... 97 4e-22 gb|ONK59069.1| uncharacterized protein A4U43_C08F2660 [Asparagus... 93 1e-20 >ref|XP_020240946.1| probable receptor-like protein kinase At4g10390 [Asparagus officinalis] Length = 188 Score = 97.1 bits (240), Expect = 4e-22 Identities = 45/60 (75%), Positives = 52/60 (86%) Frame = +2 Query: 2 MRDMGWDRLAAMVDPTLDTEFDAGELELMGVIAGRCVGGRPGLRPSMGEIVRTMKERVRL 181 MR+ GWDRL +VDPTL T FDAGELE++G IAGRCVG RPGLRPSMGEI+R M+ERV+L Sbjct: 129 MRERGWDRLEEIVDPTLRTSFDAGELEVLGDIAGRCVGDRPGLRPSMGEILRIMRERVKL 188 >gb|ONK59069.1| uncharacterized protein A4U43_C08F2660 [Asparagus officinalis] Length = 184 Score = 93.2 bits (230), Expect = 1e-20 Identities = 43/57 (75%), Positives = 49/57 (85%) Frame = +2 Query: 2 MRDMGWDRLAAMVDPTLDTEFDAGELELMGVIAGRCVGGRPGLRPSMGEIVRTMKER 172 MR+ GWDRL +VDPTL T FDAGELE++G IAGRCVG RPGLRPSMGEI+R M+ER Sbjct: 20 MRERGWDRLEEIVDPTLRTSFDAGELEVLGDIAGRCVGDRPGLRPSMGEILRIMRER 76