BLASTX nr result
ID: Ophiopogon25_contig00030340
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00030340 (876 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273607.1| probable xyloglucan endotransglucosylase/hyd... 93 2e-18 gb|ONK79265.1| uncharacterized protein A4U43_C01F4620 [Asparagus... 93 6e-18 ref|XP_020688412.1| probable xyloglucan endotransglucosylase/hyd... 63 1e-07 gb|PKA64746.1| xyloglucan:xyloglucosyl transferase [Apostasia sh... 58 9e-07 ref|XP_020589945.1| LOW QUALITY PROTEIN: probable xyloglucan end... 60 1e-06 ref|XP_021980528.1| probable xyloglucan endotransglucosylase/hyd... 58 5e-06 >ref|XP_020273607.1| probable xyloglucan endotransglucosylase/hydrolase protein 26 [Asparagus officinalis] Length = 290 Score = 93.2 bits (230), Expect = 2e-18 Identities = 45/58 (77%), Positives = 51/58 (87%) Frame = +1 Query: 91 MGNLQALFAVLISFIALANCVACANFYADTFFNWGFQNTAIWGEGGDNLALVLDNASG 264 MGNL+ALF L+S IALAN VA ANFYADTFFNWG+QNTAIWG+ GDNLAL+L+N SG Sbjct: 1 MGNLKALFIALVSNIALANSVARANFYADTFFNWGYQNTAIWGD-GDNLALILNNVSG 57 >gb|ONK79265.1| uncharacterized protein A4U43_C01F4620 [Asparagus officinalis] Length = 372 Score = 93.2 bits (230), Expect = 6e-18 Identities = 45/58 (77%), Positives = 51/58 (87%) Frame = +1 Query: 91 MGNLQALFAVLISFIALANCVACANFYADTFFNWGFQNTAIWGEGGDNLALVLDNASG 264 MGNL+ALF L+S IALAN VA ANFYADTFFNWG+QNTAIWG+ GDNLAL+L+N SG Sbjct: 1 MGNLKALFIALVSNIALANSVARANFYADTFFNWGYQNTAIWGD-GDNLALILNNVSG 57 >ref|XP_020688412.1| probable xyloglucan endotransglucosylase/hydrolase protein 26 [Dendrobium catenatum] gb|PKU87380.1| putative xyloglucan endotransglucosylase/hydrolase protein 26 [Dendrobium catenatum] Length = 290 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/55 (54%), Positives = 38/55 (69%) Frame = +1 Query: 100 LQALFAVLISFIALANCVACANFYADTFFNWGFQNTAIWGEGGDNLALVLDNASG 264 L+A L+ L + ANFY DT+FNWG+QN+AIWG+ GDNLAL+LD SG Sbjct: 4 LKAPLTALLLLSTLQISLVNANFYQDTYFNWGYQNSAIWGD-GDNLALLLDRVSG 57 >gb|PKA64746.1| xyloglucan:xyloglucosyl transferase [Apostasia shenzhenica] Length = 136 Score = 57.8 bits (138), Expect = 9e-07 Identities = 31/56 (55%), Positives = 39/56 (69%) Frame = +1 Query: 106 ALFAVLISFIALANCVACANFYADTFFNWGFQNTAIWGEGGDNLALVLDNASGINF 273 +L A+L+ AL A ANFY +TFFNWG QN+AIWG+ GDNL LVL AS + + Sbjct: 14 SLIAILV-LAALKLDPARANFYQNTFFNWGSQNSAIWGD-GDNLVLVLTKASALTW 67 >ref|XP_020589945.1| LOW QUALITY PROTEIN: probable xyloglucan endotransglucosylase/hydrolase protein 26 [Phalaenopsis equestris] Length = 350 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +1 Query: 139 LANCVACANFYADTFFNWGFQNTAIWGEGGDNLALVLDNASG 264 L + V ANF+ DTFFNWG+QN+AIWG GDNLAL+LD SG Sbjct: 69 LLSKVDAANFFQDTFFNWGYQNSAIWG-SGDNLALLLDRNSG 109 >ref|XP_021980528.1| probable xyloglucan endotransglucosylase/hydrolase protein 26 [Helianthus annuus] gb|OTG37667.1| putative concanavalin A-like lectin/glucanase domain, Xyloglucan endotransglucosylase/hydrolase [Helianthus annuus] Length = 293 Score = 58.2 bits (139), Expect = 5e-06 Identities = 27/55 (49%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = +1 Query: 103 QALFAVL-ISFIALANCVACANFYADTFFNWGFQNTAIWGEGGDNLALVLDNASG 264 QAL AV+ IS ++ +C ANFY DT+FNWG +++ I+G G+++ LVLDN +G Sbjct: 6 QALVAVVFISAVSFQSCFVNANFYTDTYFNWGAEHSYIFGANGEDVNLVLDNVAG 60