BLASTX nr result
ID: Ophiopogon25_contig00030275
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00030275 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246025.1| hippocampus abundant transcript-like protein... 71 1e-11 ref|XP_020246024.1| hippocampus abundant transcript-like protein... 71 1e-11 gb|OWM64044.1| hypothetical protein CDL15_Pgr011498 [Punica gran... 70 2e-11 gb|OVA05986.1| Major facilitator superfamily [Macleaya cordata] 69 4e-11 gb|PHU00194.1| hypothetical protein BC332_29981 [Capsicum chinense] 68 9e-11 gb|PHT65110.1| hypothetical protein T459_29535 [Capsicum annuum] 68 9e-11 ref|XP_016550555.1| PREDICTED: hippocampus abundant transcript-l... 68 9e-11 ref|XP_023885123.1| hippocampus abundant transcript-like protein... 65 1e-10 gb|PON71174.1| Major facilitator [Parasponia andersonii] 68 1e-10 gb|PON70669.1| Major facilitator [Trema orientalis] 68 1e-10 ref|XP_009594349.1| PREDICTED: hippocampus abundant transcript-l... 68 1e-10 ref|XP_016516141.1| PREDICTED: hippocampus abundant transcript-l... 68 1e-10 ref|XP_019237292.1| PREDICTED: hippocampus abundant transcript-l... 67 2e-10 ref|XP_009773274.1| PREDICTED: hippocampus abundant transcript-l... 67 2e-10 ref|XP_021837141.1| hippocampus abundant transcript-like protein... 67 2e-10 gb|KMT08413.1| hypothetical protein BVRB_6g140900 [Beta vulgaris... 67 2e-10 ref|XP_023765010.1| hippocampus abundant transcript-like protein... 67 2e-10 ref|XP_020229735.1| hippocampus abundant transcript-like protein... 67 2e-10 ref|XP_015058994.1| PREDICTED: hippocampus abundant transcript-l... 67 2e-10 ref|XP_006361454.1| PREDICTED: hippocampus abundant transcript-l... 67 2e-10 >ref|XP_020246025.1| hippocampus abundant transcript-like protein 1 isoform X2 [Asparagus officinalis] Length = 384 Score = 70.9 bits (172), Expect = 1e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 IPLCIHWIAEEMT+SVLVDVTTRALCP G+A C+EAIY Sbjct: 17 IPLCIHWIAEEMTVSVLVDVTTRALCP-GQAPCAEAIY 53 >ref|XP_020246024.1| hippocampus abundant transcript-like protein 1 isoform X1 [Asparagus officinalis] gb|ONK57416.1| uncharacterized protein A4U43_C09F290 [Asparagus officinalis] Length = 447 Score = 70.9 bits (172), Expect = 1e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 IPLCIHWIAEEMT+SVLVDVTTRALCP G+A C+EAIY Sbjct: 17 IPLCIHWIAEEMTVSVLVDVTTRALCP-GQAPCAEAIY 53 >gb|OWM64044.1| hypothetical protein CDL15_Pgr011498 [Punica granatum] Length = 456 Score = 70.1 bits (170), Expect = 2e-11 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLC+HW+AEEMT+SVLVDVTT+ALCP GE++CSEAIY Sbjct: 30 LPLCVHWVAEEMTVSVLVDVTTKALCP-GESTCSEAIY 66 >gb|OVA05986.1| Major facilitator superfamily [Macleaya cordata] Length = 403 Score = 69.3 bits (168), Expect = 4e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 IPLC+HWIAEEMT+SVLVDVTTRALCP G+ +C+EAIY Sbjct: 17 IPLCVHWIAEEMTVSVLVDVTTRALCP-GKTTCTEAIY 53 >gb|PHU00194.1| hypothetical protein BC332_29981 [Capsicum chinense] Length = 439 Score = 68.2 bits (165), Expect = 9e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLC+HWIAEEMT+SVLVDVTT ALCP G+++CSEAIY Sbjct: 17 LPLCVHWIAEEMTVSVLVDVTTSALCP-GQSTCSEAIY 53 >gb|PHT65110.1| hypothetical protein T459_29535 [Capsicum annuum] Length = 439 Score = 68.2 bits (165), Expect = 9e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLC+HWIAEEMT+SVLVDVTT ALCP G+++CSEAIY Sbjct: 17 LPLCVHWIAEEMTVSVLVDVTTSALCP-GQSTCSEAIY 53 >ref|XP_016550555.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X1 [Capsicum annuum] Length = 441 Score = 68.2 bits (165), Expect = 9e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLC+HWIAEEMT+SVLVDVTT ALCP G+++CSEAIY Sbjct: 17 LPLCVHWIAEEMTVSVLVDVTTSALCP-GQSTCSEAIY 53 >ref|XP_023885123.1| hippocampus abundant transcript-like protein 2 [Quercus suber] gb|POE69920.1| hypothetical protein CFP56_64399 [Quercus suber] Length = 141 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLC+HWIAEEMT+SVLVDV T ALCP GE++C++AIY Sbjct: 35 LPLCVHWIAEEMTVSVLVDVITNALCP-GESTCTQAIY 71 >gb|PON71174.1| Major facilitator [Parasponia andersonii] Length = 414 Score = 67.8 bits (164), Expect = 1e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLC+HWIAEEMT+SVLVDVTT ALCP G+++CSEAIY Sbjct: 18 LPLCVHWIAEEMTVSVLVDVTTGALCP-GQSTCSEAIY 54 >gb|PON70669.1| Major facilitator [Trema orientalis] Length = 414 Score = 67.8 bits (164), Expect = 1e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLC+HWIAEEMT+SVLVDVTT ALCP G+++CSEAIY Sbjct: 18 LPLCVHWIAEEMTVSVLVDVTTGALCP-GQSTCSEAIY 54 >ref|XP_009594349.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Nicotiana tomentosiformis] ref|XP_018624527.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Nicotiana tomentosiformis] Length = 417 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLCIHWIAEEMT+SVLVDVTT ALCP G ++CSEAIY Sbjct: 17 LPLCIHWIAEEMTVSVLVDVTTSALCP-GNSTCSEAIY 53 >ref|XP_016516141.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Nicotiana tabacum] Length = 441 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLCIHWIAEEMT+SVLVDVTT ALCP G ++CSEAIY Sbjct: 17 LPLCIHWIAEEMTVSVLVDVTTSALCP-GNSTCSEAIY 53 >ref|XP_019237292.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X1 [Nicotiana attenuata] gb|OIT22516.1| hypothetical protein A4A49_36070 [Nicotiana attenuata] Length = 441 Score = 67.4 bits (163), Expect = 2e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLC+HWIAEEMT+SVLVDVTT ALCP G ++CSEAIY Sbjct: 17 LPLCVHWIAEEMTVSVLVDVTTSALCP-GNSTCSEAIY 53 >ref|XP_009773274.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X1 [Nicotiana sylvestris] ref|XP_016504738.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X1 [Nicotiana tabacum] ref|XP_016504739.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X1 [Nicotiana tabacum] Length = 441 Score = 67.4 bits (163), Expect = 2e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLC+HWIAEEMT+SVLVDVTT ALCP G ++CSEAIY Sbjct: 17 LPLCVHWIAEEMTVSVLVDVTTSALCP-GNSTCSEAIY 53 >ref|XP_021837141.1| hippocampus abundant transcript-like protein 1 [Spinacia oleracea] gb|KNA16328.1| hypothetical protein SOVF_090120 [Spinacia oleracea] Length = 443 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLCIHWIAEEMT+SVLVDVTTRALCP + +CSEAIY Sbjct: 23 LPLCIHWIAEEMTVSVLVDVTTRALCP-QQTTCSEAIY 59 >gb|KMT08413.1| hypothetical protein BVRB_6g140900 [Beta vulgaris subsp. vulgaris] Length = 436 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -1 Query: 383 PLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 PLC+HWIAEEMT+SVLVDVTTRALCP + +CSEAIY Sbjct: 13 PLCVHWIAEEMTVSVLVDVTTRALCP-AQTTCSEAIY 48 >ref|XP_023765010.1| hippocampus abundant transcript-like protein 1 [Lactuca sativa] Length = 438 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLC HW+AEEMT+SVLVDVTT ALCP GE +CSEAIY Sbjct: 19 LPLCFHWVAEEMTVSVLVDVTTEALCP-GENTCSEAIY 55 >ref|XP_020229735.1| hippocampus abundant transcript-like protein 1 [Cajanus cajan] gb|KYP53008.1| Hippocampus abundant transcript-like protein 1 [Cajanus cajan] Length = 441 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLCIHW+AEEMT+SVLVDVTT ALCP G+++CS+AIY Sbjct: 18 VPLCIHWVAEEMTVSVLVDVTTSALCP-GDSTCSKAIY 54 >ref|XP_015058994.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Solanum pennellii] Length = 441 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLC+HWIAEEMT+SVLVDVTT ALCP G+ +CSEAIY Sbjct: 17 LPLCVHWIAEEMTVSVLVDVTTGALCP-GKTTCSEAIY 53 >ref|XP_006361454.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Solanum tuberosum] Length = 441 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 386 IPLCIHWIAEEMTISVLVDVTTRALCPGGEASCSEAIY 273 +PLC+HWIAEEMT+SVLVDVTT ALCP G+ +CSEAIY Sbjct: 17 LPLCVHWIAEEMTVSVLVDVTTGALCP-GKTTCSEAIY 53