BLASTX nr result
ID: Ophiopogon25_contig00030271
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00030271 (857 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020104091.1| fasciclin-like arabinogalactan protein 21 [A... 59 3e-06 ref|XP_010939965.1| PREDICTED: fasciclin-like arabinogalactan pr... 59 3e-06 >ref|XP_020104091.1| fasciclin-like arabinogalactan protein 21 [Ananas comosus] Length = 429 Score = 59.3 bits (142), Expect = 3e-06 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 4/73 (5%) Frame = -2 Query: 409 AASSYPLH-YSLSSRIAVNPPQQAQPGTP---LASILSNLGFQELSMGFPFVASILPSPW 242 AAS+Y L ++ S PPQ A+ LA ILSNLGFQEL+M P ++S + S W Sbjct: 21 AASAYALPPFNQSPSPPPPPPQSAEEAHEVLLLAPILSNLGFQELAMAVPALSSPVLSTW 80 Query: 241 SSPVTMLAPSDDS 203 S P+T+ APSDDS Sbjct: 81 SGPLTLFAPSDDS 93 >ref|XP_010939965.1| PREDICTED: fasciclin-like arabinogalactan protein 21 [Elaeis guineensis] Length = 390 Score = 58.9 bits (141), Expect = 3e-06 Identities = 30/60 (50%), Positives = 38/60 (63%) Frame = -2 Query: 382 SLSSRIAVNPPQQAQPGTPLASILSNLGFQELSMGFPFVASILPSPWSSPVTMLAPSDDS 203 S +S PPQ+ LA ILSNLGFQEL+M P + S + S WS P+T+ APSDD+ Sbjct: 22 STASGSPAPPPQEPHQAFLLAPILSNLGFQELAMAVPAIYSPVLSAWSGPLTLFAPSDDT 81