BLASTX nr result
ID: Ophiopogon25_contig00030265
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00030265 (367 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020583400.1| uncharacterized protein LOC110026692 [Phalae... 50 5e-06 >ref|XP_020583400.1| uncharacterized protein LOC110026692 [Phalaenopsis equestris] Length = 55 Score = 50.4 bits (119), Expect = 5e-06 Identities = 20/30 (66%), Positives = 29/30 (96%) Frame = -2 Query: 366 VPNIKKVMNEWASKAKRVEETYRKPKKNNE 277 VPN+KK+++EW+SKAK VEE+YRKPKK+++ Sbjct: 26 VPNMKKLLSEWSSKAKHVEESYRKPKKDDK 55