BLASTX nr result
ID: Ophiopogon25_contig00030202
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00030202 (650 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242987.1| uncharacterized protein LOC109821213 [Aspara... 58 3e-06 >ref|XP_020242987.1| uncharacterized protein LOC109821213 [Asparagus officinalis] Length = 371 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = +3 Query: 369 QLYVAVSRATSPDGLVFLINQQSGLPPGYTQNIVYKEVLQAVMEKAV 509 QLYV V RATS L FL+ +Q+ +P YTQNIVYK+VLQ VME+ V Sbjct: 206 QLYVDVLRATSRQSLKFLLGEQTDMPLNYTQNIVYKDVLQEVMEQIV 252