BLASTX nr result
ID: Ophiopogon25_contig00030079
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00030079 (534 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008807890.1| PREDICTED: U-box domain-containing protein 4... 147 8e-38 ref|XP_008794462.1| PREDICTED: U-box domain-containing protein 4... 147 8e-38 gb|AJD77270.1| hypothetical protein, partial [Populus monticola] 136 3e-37 gb|AQM53853.1| hypothetical protein 593178, partial [Populus eup... 136 3e-37 gb|AQM53837.1| hypothetical protein 593178, partial [Populus eup... 136 3e-37 ref|XP_010910720.2| PREDICTED: U-box domain-containing protein 4... 145 7e-37 ref|XP_019702663.1| PREDICTED: U-box domain-containing protein 4... 145 7e-37 ref|XP_020681061.1| U-box domain-containing protein 44-like isof... 144 9e-37 ref|XP_020681058.1| U-box domain-containing protein 44-like isof... 144 9e-37 gb|PKU59221.1| U-box domain-containing protein 44 [Dendrobium ca... 144 1e-36 gb|AJD77271.1| hypothetical protein, partial [Populus mexicana s... 133 6e-36 gb|PKA53986.1| U-box domain-containing protein 44 [Apostasia she... 140 3e-35 ref|XP_016167121.1| U-box domain-containing protein 44 [Arachis ... 139 5e-35 ref|XP_015934075.1| U-box domain-containing protein 44 [Arachis ... 139 5e-35 ref|XP_020596725.1| U-box domain-containing protein 44-like [Pha... 139 7e-35 gb|OMO56853.1| Armadillo [Corchorus olitorius] 137 3e-34 gb|OMO83401.1| Armadillo [Corchorus capsularis] 137 3e-34 ref|XP_010270500.1| PREDICTED: U-box domain-containing protein 4... 137 3e-34 ref|XP_010270497.1| PREDICTED: U-box domain-containing protein 4... 137 3e-34 ref|XP_020572397.1| U-box domain-containing protein 44-like [Pha... 137 3e-34 >ref|XP_008807890.1| PREDICTED: U-box domain-containing protein 44-like [Phoenix dactylifera] ref|XP_008807891.1| PREDICTED: U-box domain-containing protein 44-like [Phoenix dactylifera] Length = 813 Score = 147 bits (372), Expect = 8e-38 Identities = 72/79 (91%), Positives = 75/79 (94%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 EVL EN+TE+LRQRAVWAVERILRT+DIAYEISGDQ VGTALVEAFRH DYRTKQIAERA Sbjct: 735 EVLRENQTEILRQRAVWAVERILRTDDIAYEISGDQNVGTALVEAFRHGDYRTKQIAERA 794 Query: 181 LKHVDKLPNFSGIFPNMGG 237 LKHVDKLPNFSGIFP MGG Sbjct: 795 LKHVDKLPNFSGIFPKMGG 813 >ref|XP_008794462.1| PREDICTED: U-box domain-containing protein 44-like [Phoenix dactylifera] ref|XP_008794471.1| PREDICTED: U-box domain-containing protein 44-like [Phoenix dactylifera] ref|XP_008794480.1| PREDICTED: U-box domain-containing protein 44-like [Phoenix dactylifera] Length = 813 Score = 147 bits (372), Expect = 8e-38 Identities = 71/79 (89%), Positives = 75/79 (94%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 E+L ENRTE+LRQRAVWAVERILRT+DIAYEISGDQ VGTALVEAFRH DYRT+QIAERA Sbjct: 735 EILRENRTEILRQRAVWAVERILRTDDIAYEISGDQNVGTALVEAFRHGDYRTRQIAERA 794 Query: 181 LKHVDKLPNFSGIFPNMGG 237 LKHVDKLPNFSGIFP MGG Sbjct: 795 LKHVDKLPNFSGIFPKMGG 813 >gb|AJD77270.1| hypothetical protein, partial [Populus monticola] Length = 197 Score = 136 bits (343), Expect = 3e-37 Identities = 65/78 (83%), Positives = 73/78 (93%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 +VLLE RTE LR+RAVWAVER+LRTEDIAYE+SGD V TALV+AF+HADYRT+QIAERA Sbjct: 120 DVLLEKRTENLRRRAVWAVERLLRTEDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERA 179 Query: 181 LKHVDKLPNFSGIFPNMG 234 LKHVDK+PNFSGIFPNMG Sbjct: 180 LKHVDKIPNFSGIFPNMG 197 >gb|AQM53853.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53857.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53864.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53875.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53895.1| hypothetical protein 593178, partial [Populus pruinosa] Length = 199 Score = 136 bits (343), Expect = 3e-37 Identities = 65/78 (83%), Positives = 73/78 (93%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 +VLLE RTE LR+RAVWAVER+LRTEDIAYE+SGD V TALV+AF+HADYRT+QIAERA Sbjct: 122 DVLLEKRTENLRRRAVWAVERLLRTEDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERA 181 Query: 181 LKHVDKLPNFSGIFPNMG 234 LKHVDK+PNFSGIFPNMG Sbjct: 182 LKHVDKIPNFSGIFPNMG 199 >gb|AQM53837.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53838.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53839.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53840.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53841.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53842.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53843.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53844.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53845.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53846.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53847.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53848.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53849.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53850.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53851.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53852.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53854.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53855.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53856.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53858.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53859.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53860.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53861.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53862.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53863.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53865.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53866.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53867.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53868.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53869.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53870.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53871.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53872.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53873.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53874.1| hypothetical protein 593178, partial [Populus euphratica] gb|AQM53876.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53877.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53878.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53879.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53880.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53881.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53882.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53883.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53884.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53885.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53886.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53887.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53888.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53889.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53890.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53891.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53892.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53893.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53894.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53896.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53897.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53898.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53899.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53900.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53901.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53902.1| hypothetical protein 593178, partial [Populus pruinosa] gb|AQM53903.1| hypothetical protein 593178, partial [Populus pruinosa] Length = 199 Score = 136 bits (343), Expect = 3e-37 Identities = 65/78 (83%), Positives = 73/78 (93%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 +VLLE RTE LR+RAVWAVER+LRTEDIAYE+SGD V TALV+AF+HADYRT+QIAERA Sbjct: 122 DVLLEKRTENLRRRAVWAVERLLRTEDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERA 181 Query: 181 LKHVDKLPNFSGIFPNMG 234 LKHVDK+PNFSGIFPNMG Sbjct: 182 LKHVDKIPNFSGIFPNMG 199 >ref|XP_010910720.2| PREDICTED: U-box domain-containing protein 44-like [Elaeis guineensis] Length = 813 Score = 145 bits (365), Expect = 7e-37 Identities = 69/78 (88%), Positives = 74/78 (94%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 E+L ENRTE+LRQRA+WAVERILRTEDIAYEISGDQ VGTALV+AFRH DYRT+QIAERA Sbjct: 735 EILRENRTEILRQRAIWAVERILRTEDIAYEISGDQNVGTALVDAFRHGDYRTRQIAERA 794 Query: 181 LKHVDKLPNFSGIFPNMG 234 LKHVDKLPNFSGIFP MG Sbjct: 795 LKHVDKLPNFSGIFPKMG 812 >ref|XP_019702663.1| PREDICTED: U-box domain-containing protein 44-like [Elaeis guineensis] Length = 814 Score = 145 bits (365), Expect = 7e-37 Identities = 72/80 (90%), Positives = 76/80 (95%), Gaps = 1/80 (1%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 E+L ENRTE+LR+RAVWAVERILRTEDIAYEISGDQ VGTALVEAFRH DYRT+QIAERA Sbjct: 735 EILRENRTEILRKRAVWAVERILRTEDIAYEISGDQNVGTALVEAFRHGDYRTRQIAERA 794 Query: 181 LKHVDKLPNFSGIFPN-MGG 237 LKHVDKLPNFSGIFPN MGG Sbjct: 795 LKHVDKLPNFSGIFPNKMGG 814 >ref|XP_020681061.1| U-box domain-containing protein 44-like isoform X2 [Dendrobium catenatum] Length = 820 Score = 144 bits (364), Expect = 9e-37 Identities = 71/78 (91%), Positives = 74/78 (94%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 EVLLENRT+VLRQRAVWAVERILRTEDIAYEISGDQ VGTALVEAFRH DYRT+QIAERA Sbjct: 742 EVLLENRTDVLRQRAVWAVERILRTEDIAYEISGDQNVGTALVEAFRHGDYRTRQIAERA 801 Query: 181 LKHVDKLPNFSGIFPNMG 234 LKHVDKLPNFS IFP +G Sbjct: 802 LKHVDKLPNFSAIFPKVG 819 >ref|XP_020681058.1| U-box domain-containing protein 44-like isoform X1 [Dendrobium catenatum] ref|XP_020681059.1| U-box domain-containing protein 44-like isoform X1 [Dendrobium catenatum] ref|XP_020681060.1| U-box domain-containing protein 44-like isoform X1 [Dendrobium catenatum] Length = 821 Score = 144 bits (364), Expect = 9e-37 Identities = 71/78 (91%), Positives = 74/78 (94%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 EVLLENRT+VLRQRAVWAVERILRTEDIAYEISGDQ VGTALVEAFRH DYRT+QIAERA Sbjct: 743 EVLLENRTDVLRQRAVWAVERILRTEDIAYEISGDQNVGTALVEAFRHGDYRTRQIAERA 802 Query: 181 LKHVDKLPNFSGIFPNMG 234 LKHVDKLPNFS IFP +G Sbjct: 803 LKHVDKLPNFSAIFPKVG 820 >gb|PKU59221.1| U-box domain-containing protein 44 [Dendrobium catenatum] Length = 868 Score = 144 bits (364), Expect = 1e-36 Identities = 71/78 (91%), Positives = 74/78 (94%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 EVLLENRT+VLRQRAVWAVERILRTEDIAYEISGDQ VGTALVEAFRH DYRT+QIAERA Sbjct: 790 EVLLENRTDVLRQRAVWAVERILRTEDIAYEISGDQNVGTALVEAFRHGDYRTRQIAERA 849 Query: 181 LKHVDKLPNFSGIFPNMG 234 LKHVDKLPNFS IFP +G Sbjct: 850 LKHVDKLPNFSAIFPKVG 867 >gb|AJD77271.1| hypothetical protein, partial [Populus mexicana subsp. dimorpha] gb|AJD77272.1| hypothetical protein, partial [Populus mexicana] gb|AJD77273.1| hypothetical protein, partial [Populus mexicana subsp. mexicana] Length = 197 Score = 133 bits (334), Expect = 6e-36 Identities = 63/78 (80%), Positives = 72/78 (92%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 +VLLE RTE LR+RAVWAVER+LRTE+IAYE+SGD V TALV+AF+HADYRT+QIAE A Sbjct: 120 DVLLEKRTENLRRRAVWAVERLLRTEEIAYEVSGDPNVSTALVDAFQHADYRTRQIAEHA 179 Query: 181 LKHVDKLPNFSGIFPNMG 234 LKHVDK+PNFSGIFPNMG Sbjct: 180 LKHVDKIPNFSGIFPNMG 197 >gb|PKA53986.1| U-box domain-containing protein 44 [Apostasia shenzhenica] Length = 835 Score = 140 bits (353), Expect = 3e-35 Identities = 69/79 (87%), Positives = 72/79 (91%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 E+LLENRTE LRQRAVWAVERILRTE+IA EISGD VG ALVEAFRH DYRTKQIAERA Sbjct: 757 EILLENRTEFLRQRAVWAVERILRTEEIAMEISGDPNVGNALVEAFRHGDYRTKQIAERA 816 Query: 181 LKHVDKLPNFSGIFPNMGG 237 LKHVDKLPNFSGIFP +GG Sbjct: 817 LKHVDKLPNFSGIFPKIGG 835 >ref|XP_016167121.1| U-box domain-containing protein 44 [Arachis ipaensis] ref|XP_020961713.1| U-box domain-containing protein 44 [Arachis ipaensis] Length = 815 Score = 139 bits (351), Expect = 5e-35 Identities = 66/79 (83%), Positives = 74/79 (93%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 +VLLE RTE LR+RAVWAVER+LRTEDIAYE+SGDQ V TALV+AF+H DYRT+QIAERA Sbjct: 736 DVLLEKRTENLRRRAVWAVERLLRTEDIAYEVSGDQNVSTALVDAFQHGDYRTRQIAERA 795 Query: 181 LKHVDKLPNFSGIFPNMGG 237 LKHVDK+PNFSGIFPNMGG Sbjct: 796 LKHVDKIPNFSGIFPNMGG 814 >ref|XP_015934075.1| U-box domain-containing protein 44 [Arachis duranensis] ref|XP_020984192.1| U-box domain-containing protein 44 [Arachis duranensis] Length = 815 Score = 139 bits (351), Expect = 5e-35 Identities = 66/79 (83%), Positives = 74/79 (93%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 +VLLE RTE LR+RAVWAVER+LRTEDIAYE+SGDQ V TALV+AF+H DYRT+QIAERA Sbjct: 736 DVLLEKRTENLRRRAVWAVERLLRTEDIAYEVSGDQNVSTALVDAFQHGDYRTRQIAERA 795 Query: 181 LKHVDKLPNFSGIFPNMGG 237 LKHVDK+PNFSGIFPNMGG Sbjct: 796 LKHVDKIPNFSGIFPNMGG 814 >ref|XP_020596725.1| U-box domain-containing protein 44-like [Phalaenopsis equestris] ref|XP_020596726.1| U-box domain-containing protein 44-like [Phalaenopsis equestris] ref|XP_020596727.1| U-box domain-containing protein 44-like [Phalaenopsis equestris] ref|XP_020596728.1| U-box domain-containing protein 44-like [Phalaenopsis equestris] ref|XP_020596729.1| U-box domain-containing protein 44-like [Phalaenopsis equestris] ref|XP_020596730.1| U-box domain-containing protein 44-like [Phalaenopsis equestris] Length = 813 Score = 139 bits (350), Expect = 7e-35 Identities = 68/79 (86%), Positives = 73/79 (92%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 EVL ENRT+VLR+RAVWAVERILRTEDIAY ISGDQ VGTALVEAFRH DYRT+QIAERA Sbjct: 735 EVLQENRTDVLRKRAVWAVERILRTEDIAYVISGDQNVGTALVEAFRHGDYRTRQIAERA 794 Query: 181 LKHVDKLPNFSGIFPNMGG 237 LKHVDKLPNFS I+P +GG Sbjct: 795 LKHVDKLPNFSAIYPKVGG 813 >gb|OMO56853.1| Armadillo [Corchorus olitorius] Length = 780 Score = 137 bits (345), Expect = 3e-34 Identities = 66/78 (84%), Positives = 72/78 (92%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 +VLLE RTE LR+RAVW VER+LRTEDIAYEISGDQ V TALV+AF HADYRT+QIAERA Sbjct: 703 DVLLEKRTENLRRRAVWVVERLLRTEDIAYEISGDQNVSTALVDAFHHADYRTRQIAERA 762 Query: 181 LKHVDKLPNFSGIFPNMG 234 LKHVDK+PNFSGIFPNMG Sbjct: 763 LKHVDKIPNFSGIFPNMG 780 >gb|OMO83401.1| Armadillo [Corchorus capsularis] Length = 813 Score = 137 bits (345), Expect = 3e-34 Identities = 66/78 (84%), Positives = 72/78 (92%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 +VLLE RTE LR+RAVW VER+LRTEDIAYEISGDQ V TALV+AF HADYRT+QIAERA Sbjct: 736 DVLLEKRTENLRRRAVWVVERLLRTEDIAYEISGDQNVSTALVDAFHHADYRTRQIAERA 795 Query: 181 LKHVDKLPNFSGIFPNMG 234 LKHVDK+PNFSGIFPNMG Sbjct: 796 LKHVDKIPNFSGIFPNMG 813 >ref|XP_010270500.1| PREDICTED: U-box domain-containing protein 43-like isoform X2 [Nelumbo nucifera] Length = 813 Score = 137 bits (345), Expect = 3e-34 Identities = 66/78 (84%), Positives = 73/78 (93%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 EVLLENRTE+LRQRAV+AVER+LRTEDIAYE+SGD V TALV+AFRH DYRT+QIAERA Sbjct: 736 EVLLENRTEILRQRAVYAVERLLRTEDIAYEVSGDPNVSTALVDAFRHGDYRTRQIAERA 795 Query: 181 LKHVDKLPNFSGIFPNMG 234 LKHVDK+PNFSGIF NMG Sbjct: 796 LKHVDKIPNFSGIFQNMG 813 >ref|XP_010270497.1| PREDICTED: U-box domain-containing protein 43-like isoform X1 [Nelumbo nucifera] ref|XP_010270498.1| PREDICTED: U-box domain-containing protein 43-like isoform X1 [Nelumbo nucifera] ref|XP_010270499.1| PREDICTED: U-box domain-containing protein 43-like isoform X1 [Nelumbo nucifera] Length = 818 Score = 137 bits (345), Expect = 3e-34 Identities = 66/78 (84%), Positives = 73/78 (93%) Frame = +1 Query: 1 EVLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERA 180 EVLLENRTE+LRQRAV+AVER+LRTEDIAYE+SGD V TALV+AFRH DYRT+QIAERA Sbjct: 741 EVLLENRTEILRQRAVYAVERLLRTEDIAYEVSGDPNVSTALVDAFRHGDYRTRQIAERA 800 Query: 181 LKHVDKLPNFSGIFPNMG 234 LKHVDK+PNFSGIF NMG Sbjct: 801 LKHVDKIPNFSGIFQNMG 818 >ref|XP_020572397.1| U-box domain-containing protein 44-like [Phalaenopsis equestris] ref|XP_020572398.1| U-box domain-containing protein 44-like [Phalaenopsis equestris] Length = 822 Score = 137 bits (345), Expect = 3e-34 Identities = 67/77 (87%), Positives = 71/77 (92%) Frame = +1 Query: 4 VLLENRTEVLRQRAVWAVERILRTEDIAYEISGDQKVGTALVEAFRHADYRTKQIAERAL 183 VLLENRT++LRQRAVWAVERILRTEDIAYEIS DQ VGTALVEAFRH DYRT+QIAE AL Sbjct: 743 VLLENRTDLLRQRAVWAVERILRTEDIAYEISADQNVGTALVEAFRHGDYRTRQIAEHAL 802 Query: 184 KHVDKLPNFSGIFPNMG 234 KHVDKLPNFS IFP +G Sbjct: 803 KHVDKLPNFSAIFPKVG 819