BLASTX nr result
ID: Ophiopogon25_contig00030039
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00030039 (594 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264384.1| tRNA (guanine(9)-N1)-methyltransferase [Aspa... 75 3e-12 >ref|XP_020264384.1| tRNA (guanine(9)-N1)-methyltransferase [Asparagus officinalis] gb|ONK69380.1| tRNA (guanine(9)-N1)-methyltransferase [Asparagus officinalis] Length = 362 Score = 74.7 bits (182), Expect = 3e-12 Identities = 36/54 (66%), Positives = 40/54 (74%) Frame = -1 Query: 429 IQLVVEILLKISETRDWKDVIFQGIPQRKRYGGNGDAEIEETGEEDARDPPNLV 268 + VVEILLK +TRDWKD FQ IPQRKR G GDAE EETG+E+A DP LV Sbjct: 249 VNQVVEILLKFLQTRDWKDAFFQVIPQRKRDEGKGDAETEETGDENAEDPAELV 302