BLASTX nr result
ID: Ophiopogon25_contig00029572
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00029572 (556 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002456297.1| protein Mpv17 [Sorghum bicolor] >gi|24192827... 57 2e-06 gb|PKU80654.1| hypothetical protein MA16_Dca012412 [Dendrobium c... 55 5e-06 ref|XP_020675994.1| protein Mpv17 isoform X2 [Dendrobium catenatum] 55 8e-06 gb|OEL34449.1| hypothetical protein BAE44_0004533 [Dichanthelium... 56 8e-06 ref|XP_020675993.1| protein Mpv17 isoform X1 [Dendrobium catenatum] 55 8e-06 ref|NP_001152597.1| peroxisomal membrane protein 2 [Zea mays] >g... 55 9e-06 >ref|XP_002456297.1| protein Mpv17 [Sorghum bicolor] gb|EES01417.1| hypothetical protein SORBI_3003G285600 [Sorghum bicolor] Length = 241 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 469 MASYGFLLYGPGFYALYQLLDRSMPKQTF 555 MASYGFLLYGPG YA YQLLDR MPKQTF Sbjct: 121 MASYGFLLYGPGSYAWYQLLDRCMPKQTF 149 >gb|PKU80654.1| hypothetical protein MA16_Dca012412 [Dendrobium catenatum] Length = 192 Score = 55.1 bits (131), Expect = 5e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 469 MASYGFLLYGPGFYALYQLLDRSMPKQTF 555 MASYGFLLYGPG YA YQLLD+ MPKQTF Sbjct: 104 MASYGFLLYGPGSYAWYQLLDQFMPKQTF 132 >ref|XP_020675994.1| protein Mpv17 isoform X2 [Dendrobium catenatum] Length = 224 Score = 55.1 bits (131), Expect = 8e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 469 MASYGFLLYGPGFYALYQLLDRSMPKQTF 555 MASYGFLLYGPG YA YQLLD+ MPKQTF Sbjct: 104 MASYGFLLYGPGSYAWYQLLDQFMPKQTF 132 >gb|OEL34449.1| hypothetical protein BAE44_0004533 [Dichanthelium oligosanthes] Length = 378 Score = 55.8 bits (133), Expect = 8e-06 Identities = 29/61 (47%), Positives = 35/61 (57%) Frame = +1 Query: 373 ICSLLAYVINILKFDILXXXXXXXXXV*LARCMASYGFLLYGPGFYALYQLLDRSMPKQT 552 + ++ ++ N+ F L A MASYGFLLYGPG YA YQ LDR MPKQT Sbjct: 102 VTPVIPHLTNVCSFQELIPDILLNHDWLRALRMASYGFLLYGPGSYAWYQFLDRCMPKQT 161 Query: 553 F 555 F Sbjct: 162 F 162 >ref|XP_020675993.1| protein Mpv17 isoform X1 [Dendrobium catenatum] Length = 227 Score = 55.1 bits (131), Expect = 8e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 469 MASYGFLLYGPGFYALYQLLDRSMPKQTF 555 MASYGFLLYGPG YA YQLLD+ MPKQTF Sbjct: 104 MASYGFLLYGPGSYAWYQLLDQFMPKQTF 132 >ref|NP_001152597.1| peroxisomal membrane protein 2 [Zea mays] gb|ACG48427.1| peroxisomal membrane protein 2 [Zea mays] Length = 240 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +1 Query: 469 MASYGFLLYGPGFYALYQLLDRSMPKQTF 555 MASYGFLLYGPG Y YQLLDR MPKQTF Sbjct: 120 MASYGFLLYGPGSYEWYQLLDRCMPKQTF 148