BLASTX nr result
ID: Ophiopogon25_contig00029292
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00029292 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261309.1| protoheme IX farnesyltransferase, mitochondr... 60 2e-07 >ref|XP_020261309.1| protoheme IX farnesyltransferase, mitochondrial-like [Asparagus officinalis] gb|ONK72245.1| uncharacterized protein A4U43_C04F17350 [Asparagus officinalis] Length = 342 Score = 59.7 bits (143), Expect = 2e-07 Identities = 37/69 (53%), Positives = 43/69 (62%), Gaps = 4/69 (5%) Frame = +1 Query: 1 HASLLYLPVFMSGMLLHRLPNGRQESM---XXXXXXXXXISEAQERLSNDSSIHHGR-QA 168 HASLLYLPVFMS +LLHRLPN QESM ISE E L ++S ++ R Q Sbjct: 250 HASLLYLPVFMSALLLHRLPNDNQESMTTNLTGAEEGLLISETGEVLGDESHSNNRRAQV 309 Query: 169 RDLSRSQTR 195 + LSRSQ R Sbjct: 310 KGLSRSQAR 318