BLASTX nr result
ID: Ophiopogon25_contig00029258
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00029258 (769 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_024261392.1| basic proline-rich protein-like [Oncorhynchu... 44 5e-07 >ref|XP_024261392.1| basic proline-rich protein-like [Oncorhynchus tshawytscha] Length = 589 Score = 43.5 bits (101), Expect(2) = 5e-07 Identities = 25/69 (36%), Positives = 30/69 (43%) Frame = +2 Query: 542 HDTTVASPSQLPLPITLHKPAPTKLHQAQTLPTQHPNSSQTQCLLHTTSPNTQHHIHHQH 721 H+ T PS+ P P +P HP T C H P +QHH HHQ Sbjct: 276 HNPTPPGPSRRPAPPYTTRP--------------HPERPATPCT-HQAHPESQHHPHHQA 320 Query: 722 NSRQPSTTY 748 SR+ STTY Sbjct: 321 PSRETSTTY 329 Score = 38.9 bits (89), Expect(2) = 5e-07 Identities = 33/115 (28%), Positives = 43/115 (37%), Gaps = 1/115 (0%) Frame = +3 Query: 90 TGSHRSFRPPPCDILVHVPKALPMEAP-QSTNMPNIRYILTITTHQHPRTTNIQHKPRTA 266 T + + PPP I LP +AP + T+ P TT HP R A Sbjct: 186 TSTTLNHAPPPGAITT-----LPHQAPSRETSTP-------YTTRPHPE--------RPA 225 Query: 267 TNIHHTTTEHHPPSL*QQTPNLHPRDHKTPTRINNTKLNITPITTISQHRHNTTP 431 T +HH P Q P+ P P I T + P I + +HN TP Sbjct: 226 TTLHHQCPSREPAQPHHQAPSRGPAPPYPPGPIQRTSTHPAPPGPIQRDQHNPTP 280