BLASTX nr result
ID: Ophiopogon25_contig00029154
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00029154 (464 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242722.1| MATH domain and coiled-coil domain-containin... 60 5e-09 >ref|XP_020242722.1| MATH domain and coiled-coil domain-containing protein At3g58370-like [Asparagus officinalis] Length = 106 Score = 60.5 bits (145), Expect = 5e-09 Identities = 26/57 (45%), Positives = 38/57 (66%) Frame = -1 Query: 173 MGNVCIVGRKRTFKWRVEGFSSLHEAQAKCYASRPFEFGEGFWNLKIEPKHIDKKTG 3 MGN+C G+ TFKWR+EGFSSL E ++ + S PF + W L + PK+ ++K+G Sbjct: 1 MGNICSDGKSSTFKWRIEGFSSLLEHKSNHHYSHPFPYKGFNWKLMVYPKNTEEKSG 57