BLASTX nr result
ID: Ophiopogon25_contig00029006
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00029006 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242350.1| tRNA (cytosine(38)-C(5))-methyltransferase i... 64 3e-09 gb|ONK59495.1| tRNA (cytosine(38)-C(5))-methyltransferase [Aspar... 64 3e-09 ref|XP_020242352.1| tRNA (cytosine(38)-C(5))-methyltransferase i... 64 4e-09 ref|XP_010254328.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltr... 55 8e-06 ref|XP_010254327.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltr... 55 8e-06 ref|XP_010254326.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltr... 55 8e-06 ref|XP_010254325.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltr... 55 8e-06 >ref|XP_020242350.1| tRNA (cytosine(38)-C(5))-methyltransferase isoform X1 [Asparagus officinalis] ref|XP_020242351.1| tRNA (cytosine(38)-C(5))-methyltransferase isoform X1 [Asparagus officinalis] Length = 308 Score = 64.3 bits (155), Expect = 3e-09 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 447 NISIRQQYALLGNSLSIAVVASLFRYLFADPT**QKNPA 331 +ISIRQQYALLGNSLSIAVVA LFRYLF +PT QKNPA Sbjct: 267 HISIRQQYALLGNSLSIAVVAPLFRYLFTEPTREQKNPA 305 >gb|ONK59495.1| tRNA (cytosine(38)-C(5))-methyltransferase [Asparagus officinalis] Length = 337 Score = 64.3 bits (155), Expect = 3e-09 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 447 NISIRQQYALLGNSLSIAVVASLFRYLFADPT**QKNPA 331 +ISIRQQYALLGNSLSIAVVA LFRYLF +PT QKNPA Sbjct: 296 HISIRQQYALLGNSLSIAVVAPLFRYLFTEPTREQKNPA 334 >ref|XP_020242352.1| tRNA (cytosine(38)-C(5))-methyltransferase isoform X2 [Asparagus officinalis] Length = 376 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 447 NISIRQQYALLGNSLSIAVVASLFRYLFADPT**QKNPA 331 +ISIRQQYALLGNSLSIAVVA LFRYLF +PT QKNPA Sbjct: 335 HISIRQQYALLGNSLSIAVVAPLFRYLFTEPTREQKNPA 373 >ref|XP_010254328.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase isoform X4 [Nelumbo nucifera] Length = 311 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 447 NISIRQQYALLGNSLSIAVVASLFRYLFADPT 352 +IS+RQ+YALLGNSLS+AVVA LFRYLF+DP+ Sbjct: 280 HISLRQRYALLGNSLSVAVVAPLFRYLFSDPS 311 >ref|XP_010254327.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase isoform X3 [Nelumbo nucifera] Length = 377 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 447 NISIRQQYALLGNSLSIAVVASLFRYLFADPT 352 +IS+RQ+YALLGNSLS+AVVA LFRYLF+DP+ Sbjct: 346 HISLRQRYALLGNSLSVAVVAPLFRYLFSDPS 377 >ref|XP_010254326.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase isoform X2 [Nelumbo nucifera] Length = 384 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 447 NISIRQQYALLGNSLSIAVVASLFRYLFADPT 352 +IS+RQ+YALLGNSLS+AVVA LFRYLF+DP+ Sbjct: 353 HISLRQRYALLGNSLSVAVVAPLFRYLFSDPS 384 >ref|XP_010254325.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase isoform X1 [Nelumbo nucifera] Length = 388 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 447 NISIRQQYALLGNSLSIAVVASLFRYLFADPT 352 +IS+RQ+YALLGNSLS+AVVA LFRYLF+DP+ Sbjct: 357 HISLRQRYALLGNSLSVAVVAPLFRYLFSDPS 388