BLASTX nr result
ID: Ophiopogon25_contig00028963
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00028963 (574 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242791.1| uncharacterized protein LOC109821008 [Aspara... 55 9e-07 >ref|XP_020242791.1| uncharacterized protein LOC109821008 [Asparagus officinalis] gb|ONK59839.1| uncharacterized protein A4U43_C08F11490 [Asparagus officinalis] Length = 392 Score = 55.5 bits (132), Expect(2) = 9e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 132 SVEAVDLMGFPDTISQYRHTIDSAPVPMIDANLNPQSLEAASK 4 SV AV+ P+ I Q+RHTI SAPV M+DANL+P+SLEAASK Sbjct: 147 SVAAVERFVTPEIIQQFRHTICSAPVLMVDANLHPRSLEAASK 189 Score = 25.0 bits (53), Expect(2) = 9e-07 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 172 TFDSRGELAAGVA 134 TFD RGELA GVA Sbjct: 134 TFDYRGELAVGVA 146