BLASTX nr result
ID: Ophiopogon25_contig00028910
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00028910 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001771620.1| predicted protein [Physcomitrella patens] >g... 59 3e-07 dbj|BAK52370.1| 14-3-3 protein, partial [Eleusine coracana] 54 6e-07 ref|XP_020083214.1| 14-3-3-like protein GF14 kappa [Ananas comosus] 57 1e-06 gb|AAD27822.1| 14-3-3 protein, partial [Populus tremula x Populu... 54 1e-06 gb|ABV72553.1| 14-3-3 protein [Heterocapsa rotundata] 57 1e-06 ref|XP_011397541.1| 14-3-3-like protein, partial [Auxenochlorell... 54 1e-06 ref|XP_018833854.1| PREDICTED: 14-3-3-like protein B [Juglans re... 57 2e-06 gb|PPS11598.1| hypothetical protein GOBAR_AA09022 [Gossypium bar... 55 2e-06 gb|AAD27825.1| 14-3-3 protein, partial [Populus tremula x Populu... 54 2e-06 ref|XP_006841231.1| 14-3-3-like protein GF14 kappa [Amborella tr... 56 2e-06 gb|PKA64805.1| 14-3-3-like protein GF14 kappa [Apostasia shenzhe... 56 2e-06 gb|AFK39669.1| unknown [Medicago truncatula] 54 3e-06 gb|ANA09003.1| 14-3-3 protein-like protein [Eleusine coracana] 56 3e-06 gb|KDO60622.1| hypothetical protein CISIN_1g024800mg [Citrus sin... 55 3e-06 ref|XP_002445779.1| 14-3-3-like protein GF14-C [Sorghum bicolor]... 56 3e-06 ref|XP_004974053.1| 14-3-3-like protein GF14-C [Setaria italica]... 56 3e-06 gb|PPE00641.1| hypothetical protein GOBAR_DD02365 [Gossypium bar... 54 3e-06 gb|PAN36481.1| hypothetical protein PAHAL_F00538 [Panicum hallii] 56 3e-06 gb|PAN35426.1| hypothetical protein PAHAL_F02045 [Panicum hallii] 56 3e-06 gb|OEL36263.1| 14-3-3-like protein GF14-C [Dichanthelium oligosa... 56 3e-06 >ref|XP_001771620.1| predicted protein [Physcomitrella patens] gb|PNR57153.1| hypothetical protein PHYPA_004146 [Physcomitrella patens] Length = 259 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEEIDEVAPPWSCRV 391 VAYKN++ ARRA+WRI+SSIEQKEEGK N E EV + +V Sbjct: 51 VAYKNVIGARRASWRIISSIEQKEEGKDNAEFAEVIKAYRAKV 93 >dbj|BAK52370.1| 14-3-3 protein, partial [Eleusine coracana] Length = 52 Score = 53.9 bits (128), Expect = 6e-07 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEE 355 VAYKN++ ARRA+WRI+SSIEQKEEG+ NE+ Sbjct: 12 VAYKNVIGARRASWRIISSIEQKEEGRGNED 42 >ref|XP_020083214.1| 14-3-3-like protein GF14 kappa [Ananas comosus] Length = 250 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEEIDEVAPPWSCRV 391 VAYKN+V ARRAAWRIVSS+EQKE+G++ EE +A + R+ Sbjct: 55 VAYKNLVGARRAAWRIVSSVEQKEQGRREEERAALARSYRARI 97 >gb|AAD27822.1| 14-3-3 protein, partial [Populus tremula x Populus alba] Length = 105 Score = 54.3 bits (129), Expect = 1e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEE 355 VAYKN++ + RAAWRIVSSIEQKEEG+KNE+ Sbjct: 37 VAYKNVIGSLRAAWRIVSSIEQKEEGRKNED 67 >gb|ABV72553.1| 14-3-3 protein [Heterocapsa rotundata] Length = 237 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEEIDEVAPPWSCRV 391 VAYKN V +RRAAWRI++S+EQKE+ K NEE A +SC+V Sbjct: 46 VAYKNAVGSRRAAWRIITSVEQKEKSKGNEEQAAYAKEYSCKV 88 >ref|XP_011397541.1| 14-3-3-like protein, partial [Auxenochlorella protothecoides] gb|KFM24653.1| 14-3-3-like protein, partial [Auxenochlorella protothecoides] Length = 93 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEE 355 VAYKN++ ARRA+WRI+SSIEQKEE K NEE Sbjct: 52 VAYKNVIGARRASWRIISSIEQKEESKGNEE 82 >ref|XP_018833854.1| PREDICTED: 14-3-3-like protein B [Juglans regia] Length = 252 Score = 56.6 bits (135), Expect = 2e-06 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEEIDEVAPPWSCRV-GEISSRGDEGLG 427 VAYKN++ + RAAWRIVSSIEQKEEG+KNEE + + +V E+S D LG Sbjct: 57 VAYKNVIGSLRAAWRIVSSIEQKEEGRKNEEHVTLVKDYRSKVESELSQVCDSILG 112 >gb|PPS11598.1| hypothetical protein GOBAR_AA09022 [Gossypium barbadense] Length = 175 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEE 355 VAYKN++ + RAAWRIVSSIEQKEEG+KNEE Sbjct: 57 VAYKNVIGSLRAAWRIVSSIEQKEEGRKNEE 87 >gb|AAD27825.1| 14-3-3 protein, partial [Populus tremula x Populus alba] Length = 125 Score = 54.3 bits (129), Expect = 2e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEE 355 VAYKN++ + RAAWRIVSSIEQKEEG+KNE+ Sbjct: 37 VAYKNVIGSLRAAWRIVSSIEQKEEGRKNED 67 >ref|XP_006841231.1| 14-3-3-like protein GF14 kappa [Amborella trichopoda] gb|ERN02906.1| hypothetical protein AMTR_s00135p00062550 [Amborella trichopoda] Length = 247 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEEIDEVAPPWSCRV 391 VAYKN++ ARRA+WRIVSSIEQKEE +KNEE V + +V Sbjct: 52 VAYKNVIGARRASWRIVSSIEQKEESRKNEEHVAVVKNYRAKV 94 >gb|PKA64805.1| 14-3-3-like protein GF14 kappa [Apostasia shenzhenica] Length = 250 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEEIDEVAPPWSCRV 391 VAYKN+V ARRAAWRIVSSIEQKEE ++N+E + + R+ Sbjct: 55 VAYKNLVGARRAAWRIVSSIEQKEENRRNDEHAALVKDYRARI 97 >gb|AFK39669.1| unknown [Medicago truncatula] Length = 133 Score = 54.3 bits (129), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEE 355 VAYKN++ + RAAWRIVSSIEQKEEG+KNE+ Sbjct: 57 VAYKNVIGSLRAAWRIVSSIEQKEEGRKNED 87 >gb|ANA09003.1| 14-3-3 protein-like protein [Eleusine coracana] Length = 252 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEE 355 VAYKN++ ARRA+WRIVSSIEQKEE +KNEE Sbjct: 48 VAYKNVIGARRASWRIVSSIEQKEESRKNEE 78 >gb|KDO60622.1| hypothetical protein CISIN_1g024800mg [Citrus sinensis] gb|KDO60623.1| hypothetical protein CISIN_1g024800mg [Citrus sinensis] Length = 186 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEE 355 VAYKN++ + RAAWRI+SSIEQKEEG+KNEE Sbjct: 52 VAYKNVIGSLRAAWRIISSIEQKEEGRKNEE 82 >ref|XP_002445779.1| 14-3-3-like protein GF14-C [Sorghum bicolor] ref|XP_021320157.1| 14-3-3-like protein GF14-C [Sorghum bicolor] gb|EES15274.1| hypothetical protein SORBI_3007G186800 [Sorghum bicolor] Length = 253 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEE 355 VAYKN++ ARRA+WRIVSSIEQKEE +KNEE Sbjct: 48 VAYKNVIGARRASWRIVSSIEQKEESRKNEE 78 >ref|XP_004974053.1| 14-3-3-like protein GF14-C [Setaria italica] gb|KQL02730.1| hypothetical protein SETIT_014320mg [Setaria italica] Length = 255 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEE 355 VAYKN++ ARRA+WRIVSSIEQKEE +KNEE Sbjct: 48 VAYKNVIGARRASWRIVSSIEQKEESRKNEE 78 >gb|PPE00641.1| hypothetical protein GOBAR_DD02365 [Gossypium barbadense] Length = 111 Score = 53.5 bits (127), Expect = 3e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEEIDEVAPPWSCRV 391 VAYKN++ ARRA+WRIVSSIEQKEEG N + D V + ++ Sbjct: 41 VAYKNVIGARRASWRIVSSIEQKEEGHGNADHDAVILQYKSKI 83 >gb|PAN36481.1| hypothetical protein PAHAL_F00538 [Panicum hallii] Length = 256 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEE 355 VAYKN++ ARRA+WRIVSSIEQKEE +KNEE Sbjct: 48 VAYKNVIGARRASWRIVSSIEQKEESRKNEE 78 >gb|PAN35426.1| hypothetical protein PAHAL_F02045 [Panicum hallii] Length = 256 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEE 355 VAYKN++ ARRA+WRIVSSIEQKEE +KNEE Sbjct: 48 VAYKNVIGARRASWRIVSSIEQKEESRKNEE 78 >gb|OEL36263.1| 14-3-3-like protein GF14-C [Dichanthelium oligosanthes] Length = 256 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 263 VAYKNMVAARRAAWRIVSSIEQKEEGKKNEE 355 VAYKN++ ARRA+WRIVSSIEQKEE +KNEE Sbjct: 48 VAYKNVIGARRASWRIVSSIEQKEESRKNEE 78