BLASTX nr result
ID: Ophiopogon25_contig00028873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00028873 (793 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago ... 67 8e-11 ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 66 2e-10 gb|PAN34016.1| hypothetical protein PAHAL_F01282, partial [Panic... 57 5e-07 >ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gb|AES87819.1| hypothetical protein MTR_4g035030 [Medicago truncatula] Length = 95 Score = 67.4 bits (163), Expect = 8e-11 Identities = 35/41 (85%), Positives = 35/41 (85%) Frame = +1 Query: 427 MAKLVDATDLIGLSLSMETC*VVTSKFRETLERKMGNPEPN 549 MAKLVDATDLIGLSL MET V T KFRETLE KMGNPEPN Sbjct: 1 MAKLVDATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPN 41 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 65.9 bits (159), Expect = 2e-10 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +1 Query: 427 MAKLVDATDLIGLSLSMETC*VVTSKFRETLERKMGNPEPN 549 MA+LVDATDLIGLSL MET V T KFRETLE KMGNPEPN Sbjct: 1 MAELVDATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPN 41 >gb|PAN34016.1| hypothetical protein PAHAL_F01282, partial [Panicum hallii] Length = 96 Score = 57.0 bits (136), Expect = 5e-07 Identities = 32/51 (62%), Positives = 33/51 (64%), Gaps = 5/51 (9%) Frame = -2 Query: 621 SIESLHLSLFILVFK-----RKPFFLKIKIWLRIAHFSFQGFSEFGSYHLA 484 S+E L LSL F R F K IWLRIAHFSFQGFSEFGSYHLA Sbjct: 46 SLEQLPLSLCTYPFPLGSSLRTTCFFKKGIWLRIAHFSFQGFSEFGSYHLA 96