BLASTX nr result
ID: Ophiopogon25_contig00028633
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00028633 (379 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261925.1| squamous cell carcinoma antigen recognized b... 56 1e-06 ref|XP_020261924.1| squamous cell carcinoma antigen recognized b... 56 1e-06 >ref|XP_020261925.1| squamous cell carcinoma antigen recognized by T-cells 3 isoform X2 [Asparagus officinalis] Length = 832 Score = 56.2 bits (134), Expect = 1e-06 Identities = 32/64 (50%), Positives = 38/64 (59%), Gaps = 2/64 (3%) Frame = -2 Query: 378 NDRSDTSIPKPVSKEKHDDGVKLVGRTAFL--PRAVIPLGRTNKEAKAADNSEQPKSNDE 205 N+ TS V + + VK +GR F PRAV L +NKE K ADN E+PKSNDE Sbjct: 765 NEHGGTSRTAKVVVTEGESEVKPIGRNTFFAAPRAVRSLAGSNKEPKGADNIEEPKSNDE 824 Query: 204 FRAM 193 FRAM Sbjct: 825 FRAM 828 >ref|XP_020261924.1| squamous cell carcinoma antigen recognized by T-cells 3 isoform X1 [Asparagus officinalis] gb|ONK73079.1| uncharacterized protein A4U43_C04F26940 [Asparagus officinalis] Length = 848 Score = 56.2 bits (134), Expect = 1e-06 Identities = 32/64 (50%), Positives = 38/64 (59%), Gaps = 2/64 (3%) Frame = -2 Query: 378 NDRSDTSIPKPVSKEKHDDGVKLVGRTAFL--PRAVIPLGRTNKEAKAADNSEQPKSNDE 205 N+ TS V + + VK +GR F PRAV L +NKE K ADN E+PKSNDE Sbjct: 781 NEHGGTSRTAKVVVTEGESEVKPIGRNTFFAAPRAVRSLAGSNKEPKGADNIEEPKSNDE 840 Query: 204 FRAM 193 FRAM Sbjct: 841 FRAM 844