BLASTX nr result
ID: Ophiopogon25_contig00028552
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00028552 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010923721.1| PREDICTED: RNA polymerase II subunit 5-media... 55 4e-06 >ref|XP_010923721.1| PREDICTED: RNA polymerase II subunit 5-mediating protein homolog [Elaeis guineensis] Length = 346 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/46 (50%), Positives = 35/46 (76%) Frame = +2 Query: 2 PDPKENLHNSSDLKLKDTSDKVTSETDIMNFSGRKAFTGTVIEHTH 139 P+PKENLH +S LKL+D+S+ +T + S R+AFTG+++EH+H Sbjct: 266 PEPKENLHQASVLKLEDSSENSARQTFKIGSSSRRAFTGSIVEHSH 311