BLASTX nr result
ID: Ophiopogon25_contig00027506
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00027506 (412 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC51220.1| zinc finger protein 541 [Rhizophagus irregularis... 82 5e-16 gb|PKY50931.1| hypothetical protein RhiirA4_407004, partial [Rhi... 82 1e-15 gb|PKB99420.1| hypothetical protein RhiirA5_366415, partial [Rhi... 82 1e-15 gb|PKC59211.1| hypothetical protein RhiirA1_427118 [Rhizophagus ... 82 1e-15 gb|EXX76467.1| hypothetical protein RirG_033020 [Rhizophagus irr... 82 1e-15 >dbj|GBC51220.1| zinc finger protein 541 [Rhizophagus irregularis DAOM 181602] Length = 283 Score = 82.0 bits (201), Expect = 5e-16 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = -2 Query: 348 SIKQVVEFYYLIKHTPEFRKAKAMKKELELYEEEVNKNDALI 223 S QVVEFYYLIKHTPEFRKAKAMKKELELYEEEVNKNDALI Sbjct: 221 STAQVVEFYYLIKHTPEFRKAKAMKKELELYEEEVNKNDALI 262 >gb|PKY50931.1| hypothetical protein RhiirA4_407004, partial [Rhizophagus irregularis] Length = 352 Score = 82.0 bits (201), Expect = 1e-15 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = -2 Query: 348 SIKQVVEFYYLIKHTPEFRKAKAMKKELELYEEEVNKNDALI 223 S QVVEFYYLIKHTPEFRKAKAMKKELELYEEEVNKNDALI Sbjct: 291 STAQVVEFYYLIKHTPEFRKAKAMKKELELYEEEVNKNDALI 332 >gb|PKB99420.1| hypothetical protein RhiirA5_366415, partial [Rhizophagus irregularis] gb|PKY20724.1| hypothetical protein RhiirB3_408633, partial [Rhizophagus irregularis] Length = 352 Score = 82.0 bits (201), Expect = 1e-15 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = -2 Query: 348 SIKQVVEFYYLIKHTPEFRKAKAMKKELELYEEEVNKNDALI 223 S QVVEFYYLIKHTPEFRKAKAMKKELELYEEEVNKNDALI Sbjct: 291 STAQVVEFYYLIKHTPEFRKAKAMKKELELYEEEVNKNDALI 332 >gb|PKC59211.1| hypothetical protein RhiirA1_427118 [Rhizophagus irregularis] Length = 353 Score = 82.0 bits (201), Expect = 1e-15 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = -2 Query: 348 SIKQVVEFYYLIKHTPEFRKAKAMKKELELYEEEVNKNDALI 223 S QVVEFYYLIKHTPEFRKAKAMKKELELYEEEVNKNDALI Sbjct: 291 STAQVVEFYYLIKHTPEFRKAKAMKKELELYEEEVNKNDALI 332 >gb|EXX76467.1| hypothetical protein RirG_033020 [Rhizophagus irregularis DAOM 197198w] gb|PKK72212.1| hypothetical protein RhiirC2_743221 [Rhizophagus irregularis] gb|POG65553.1| hypothetical protein GLOIN_2v1665492 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 353 Score = 82.0 bits (201), Expect = 1e-15 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = -2 Query: 348 SIKQVVEFYYLIKHTPEFRKAKAMKKELELYEEEVNKNDALI 223 S QVVEFYYLIKHTPEFRKAKAMKKELELYEEEVNKNDALI Sbjct: 291 STAQVVEFYYLIKHTPEFRKAKAMKKELELYEEEVNKNDALI 332