BLASTX nr result
ID: Ophiopogon25_contig00027191
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00027191 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246466.1| DDT domain-containing protein DDB_G0282237 [... 82 2e-15 ref|XP_008795248.1| PREDICTED: DDT domain-containing protein DDB... 79 1e-14 ref|XP_010912638.1| PREDICTED: DDT domain-containing protein DDB... 78 3e-14 ref|XP_008786498.1| PREDICTED: DDT domain-containing protein DDB... 75 4e-13 ref|XP_010930587.1| PREDICTED: DDT domain-containing protein DDB... 74 8e-13 gb|PKA66760.1| DNA mismatch repair protein MLH1 [Apostasia shenz... 72 4e-12 gb|EEE61052.1| hypothetical protein OsJ_14909 [Oryza sativa Japo... 68 7e-12 dbj|BAS89333.1| Os04g0439300, partial [Oryza sativa Japonica Group] 68 1e-11 ref|XP_020111994.1| DDT domain-containing protein DDB_G0282237 i... 70 2e-11 gb|OAY63778.1| Bromodomain adjacent to zinc finger domain protei... 70 2e-11 ref|XP_020111993.1| DDT domain-containing protein DDB_G0282237 i... 70 2e-11 ref|XP_015623176.1| PREDICTED: DDT domain-containing protein DDB... 70 3e-11 ref|XP_015623175.1| PREDICTED: DDT domain-containing protein DDB... 70 3e-11 gb|EEC73402.1| hypothetical protein OsI_07656 [Oryza sativa Indi... 70 3e-11 ref|XP_020679644.1| DDT domain-containing protein DDB_G0282237 [... 70 3e-11 ref|XP_009390085.1| PREDICTED: DDT domain-containing protein DDB... 70 3e-11 gb|EEE57193.1| hypothetical protein OsJ_07138 [Oryza sativa Japo... 70 3e-11 ref|XP_004952786.1| DDT domain-containing protein DDB_G0282237 [... 69 4e-11 gb|PKI60279.1| hypothetical protein CRG98_019334 [Punica granatum] 65 5e-11 ref|XP_020573624.1| DDT domain-containing protein DDB_G0282237 i... 69 6e-11 >ref|XP_020246466.1| DDT domain-containing protein DDB_G0282237 [Asparagus officinalis] ref|XP_020246467.1| DDT domain-containing protein DDB_G0282237 [Asparagus officinalis] ref|XP_020246468.1| DDT domain-containing protein DDB_G0282237 [Asparagus officinalis] gb|ONK57685.1| uncharacterized protein A4U43_C09F3020 [Asparagus officinalis] Length = 729 Score = 81.6 bits (200), Expect = 2e-15 Identities = 38/54 (70%), Positives = 44/54 (81%) Frame = +1 Query: 4 KHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKPPFITYVNKWKDD 165 KHY ++S ALQKR+K+ AQ ALLEDSE RRSTRVR + R KP F +YVNKWKDD Sbjct: 676 KHYQKMSMALQKRSKEAAQNALLEDSERRRSTRVRVEARKKPAFFSYVNKWKDD 729 >ref|XP_008795248.1| PREDICTED: DDT domain-containing protein DDB_G0282237-like [Phoenix dactylifera] Length = 700 Score = 79.3 bits (194), Expect = 1e-14 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 2/57 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKDD 165 +K+YHRISTALQKR+K VAQK LLE++ LRRSTRVRA+PR P F+ YVNKWK++ Sbjct: 644 EKYYHRISTALQKRSKDVAQKILLEEAVLRRSTRVRAQPRDSPAMAFLRYVNKWKEN 700 >ref|XP_010912638.1| PREDICTED: DDT domain-containing protein DDB_G0282237-like [Elaeis guineensis] ref|XP_010912639.1| PREDICTED: DDT domain-containing protein DDB_G0282237-like [Elaeis guineensis] ref|XP_019703453.1| PREDICTED: DDT domain-containing protein DDB_G0282237-like [Elaeis guineensis] Length = 698 Score = 78.2 bits (191), Expect = 3e-14 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 2/57 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKDD 165 +K YHRISTALQKR+K VAQK LLE++ LRRSTRVRA+PR P F+ YVNKWK++ Sbjct: 642 EKFYHRISTALQKRSKDVAQKILLEEAVLRRSTRVRAQPRDSPAMAFLRYVNKWKEN 698 >ref|XP_008786498.1| PREDICTED: DDT domain-containing protein DDB_G0282237-like [Phoenix dactylifera] Length = 701 Score = 75.1 bits (183), Expect = 4e-13 Identities = 38/57 (66%), Positives = 47/57 (82%), Gaps = 2/57 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKDD 165 +K+Y RISTALQKR+K VAQK LLE++ LRRSTRVRA+PR P F+ YVNKWK++ Sbjct: 645 EKYYLRISTALQKRSKDVAQKILLEEAVLRRSTRVRAQPRDSPAMAFLRYVNKWKEN 701 >ref|XP_010930587.1| PREDICTED: DDT domain-containing protein DDB_G0282237-like [Elaeis guineensis] Length = 700 Score = 74.3 bits (181), Expect = 8e-13 Identities = 38/56 (67%), Positives = 46/56 (82%), Gaps = 2/56 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKD 162 +K+Y RISTALQKR+K VAQK LLE++ LRRSTRVRA+PR P F+ YVNKWK+ Sbjct: 645 EKYYLRISTALQKRSKDVAQKILLEEAVLRRSTRVRAQPRDSPAMAFLRYVNKWKN 700 >gb|PKA66760.1| DNA mismatch repair protein MLH1 [Apostasia shenzhenica] Length = 1422 Score = 72.4 bits (176), Expect = 4e-12 Identities = 33/56 (58%), Positives = 46/56 (82%), Gaps = 2/56 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKD 162 +K+Y +IS ALQKR+K +A+KAL++++ELRRSTRVRA+PR P F+ Y NKWK+ Sbjct: 1353 EKYYVKISNALQKRSKSIAEKALIQETELRRSTRVRAQPRCSPAMAFLRYANKWKE 1408 >gb|EEE61052.1| hypothetical protein OsJ_14909 [Oryza sativa Japonica Group] Length = 126 Score = 67.8 bits (164), Expect = 7e-12 Identities = 33/57 (57%), Positives = 44/57 (77%), Gaps = 2/57 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKPP--FITYVNKWKDD 165 DK Y+ IS AL+KRTK V QK LL+++ LRRS+RV+A+PR P F+ YVNKWK++ Sbjct: 70 DKFYNTISNALEKRTKDVTQKMLLQEAALRRSSRVQAQPRDNPSMLFLKYVNKWKEN 126 >dbj|BAS89333.1| Os04g0439300, partial [Oryza sativa Japonica Group] Length = 153 Score = 67.8 bits (164), Expect = 1e-11 Identities = 33/57 (57%), Positives = 44/57 (77%), Gaps = 2/57 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKPP--FITYVNKWKDD 165 DK Y+ IS AL+KRTK V QK LL+++ LRRS+RV+A+PR P F+ YVNKWK++ Sbjct: 97 DKFYNTISNALEKRTKDVTQKMLLQEAALRRSSRVQAQPRDNPSMLFLKYVNKWKEN 153 >ref|XP_020111994.1| DDT domain-containing protein DDB_G0282237 isoform X2 [Ananas comosus] Length = 625 Score = 70.1 bits (170), Expect = 2e-11 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 2/56 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKD 162 +K Y +IS AL+KRTK +AQK LLE++ LRRSTRVRA+PR P F+ YVN+WK+ Sbjct: 569 EKFYQKISMALEKRTKDIAQKILLEEAVLRRSTRVRAQPRDNPNMAFLKYVNRWKE 624 >gb|OAY63778.1| Bromodomain adjacent to zinc finger domain protein 1A [Ananas comosus] Length = 625 Score = 70.1 bits (170), Expect = 2e-11 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 2/56 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKD 162 +K Y +IS AL+KRTK +AQK LLE++ LRRSTRVRA+PR P F+ YVN+WK+ Sbjct: 569 EKFYQKISMALEKRTKDIAQKILLEEAVLRRSTRVRAQPRDNPNMAFLKYVNRWKE 624 >ref|XP_020111993.1| DDT domain-containing protein DDB_G0282237 isoform X1 [Ananas comosus] Length = 628 Score = 70.1 bits (170), Expect = 2e-11 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 2/56 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKD 162 +K Y +IS AL+KRTK +AQK LLE++ LRRSTRVRA+PR P F+ YVN+WK+ Sbjct: 572 EKFYQKISMALEKRTKDIAQKILLEEAVLRRSTRVRAQPRDNPNMAFLKYVNRWKE 627 >ref|XP_015623176.1| PREDICTED: DDT domain-containing protein DDB_G0282237 isoform X2 [Oryza sativa Japonica Group] Length = 615 Score = 69.7 bits (169), Expect = 3e-11 Identities = 34/57 (59%), Positives = 44/57 (77%), Gaps = 2/57 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKDD 165 DK Y +IS AL+KR+K++ K LLE++ LRRSTRVRA+PR P F+ YVNKWKD+ Sbjct: 559 DKLYSKISNALEKRSKEITHKLLLEEAVLRRSTRVRAQPRDNPSMSFLKYVNKWKDN 615 >ref|XP_015623175.1| PREDICTED: DDT domain-containing protein DDB_G0282237 isoform X1 [Oryza sativa Japonica Group] dbj|BAD15468.1| putative DDT domain-containing protein [Oryza sativa Japonica Group] dbj|BAF09048.1| Os02g0556900 [Oryza sativa Japonica Group] dbj|BAG90398.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAS79222.1| Os02g0556900 [Oryza sativa Japonica Group] Length = 617 Score = 69.7 bits (169), Expect = 3e-11 Identities = 34/57 (59%), Positives = 44/57 (77%), Gaps = 2/57 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKDD 165 DK Y +IS AL+KR+K++ K LLE++ LRRSTRVRA+PR P F+ YVNKWKD+ Sbjct: 561 DKLYSKISNALEKRSKEITHKLLLEEAVLRRSTRVRAQPRDNPSMSFLKYVNKWKDN 617 >gb|EEC73402.1| hypothetical protein OsI_07656 [Oryza sativa Indica Group] Length = 643 Score = 69.7 bits (169), Expect = 3e-11 Identities = 34/57 (59%), Positives = 44/57 (77%), Gaps = 2/57 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKDD 165 DK Y +IS AL+KR+K++ K LLE++ LRRSTRVRA+PR P F+ YVNKWKD+ Sbjct: 587 DKLYSKISNALEKRSKEITHKLLLEEAVLRRSTRVRAQPRDNPSMSFLKYVNKWKDN 643 >ref|XP_020679644.1| DDT domain-containing protein DDB_G0282237 [Dendrobium catenatum] ref|XP_020679645.1| DDT domain-containing protein DDB_G0282237 [Dendrobium catenatum] ref|XP_020679647.1| DDT domain-containing protein DDB_G0282237 [Dendrobium catenatum] ref|XP_020679648.1| DDT domain-containing protein DDB_G0282237 [Dendrobium catenatum] gb|PKU82003.1| hypothetical protein MA16_Dca004020 [Dendrobium catenatum] Length = 692 Score = 69.7 bits (169), Expect = 3e-11 Identities = 33/56 (58%), Positives = 44/56 (78%), Gaps = 2/56 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKD 162 +K+Y +ISTALQKR+K +AQKAL+++ ELRRS RVR++PR P F Y NKWK+ Sbjct: 613 EKYYVKISTALQKRSKDIAQKALMDEGELRRSARVRSQPRCSPAMAFHKYTNKWKE 668 >ref|XP_009390085.1| PREDICTED: DDT domain-containing protein DDB_G0282237 [Musa acuminata subsp. malaccensis] ref|XP_018675365.1| PREDICTED: DDT domain-containing protein DDB_G0282237 [Musa acuminata subsp. malaccensis] Length = 693 Score = 69.7 bits (169), Expect = 3e-11 Identities = 34/57 (59%), Positives = 46/57 (80%), Gaps = 2/57 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPR--AKPPFITYVNKWKDD 165 +K+Y+RIS ALQKR+K +AQK LLE++ LRRSTRVRA+PR + F+ Y NKWK++ Sbjct: 637 EKYYNRISLALQKRSKDIAQKVLLEENVLRRSTRVRAQPRDSSATAFLRYKNKWKEN 693 >gb|EEE57193.1| hypothetical protein OsJ_07138 [Oryza sativa Japonica Group] Length = 720 Score = 69.7 bits (169), Expect = 3e-11 Identities = 34/57 (59%), Positives = 44/57 (77%), Gaps = 2/57 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKDD 165 DK Y +IS AL+KR+K++ K LLE++ LRRSTRVRA+PR P F+ YVNKWKD+ Sbjct: 664 DKLYSKISNALEKRSKEITHKLLLEEAVLRRSTRVRAQPRDNPSMSFLKYVNKWKDN 720 >ref|XP_004952786.1| DDT domain-containing protein DDB_G0282237 [Setaria italica] ref|XP_022685233.1| DDT domain-containing protein DDB_G0282237 [Setaria italica] gb|KQL30028.1| hypothetical protein SETIT_016648mg [Setaria italica] Length = 623 Score = 69.3 bits (168), Expect = 4e-11 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 2/57 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKDD 165 +K+Y++IS L+KRTK++ K LLE+ LRRSTRVRA+P+ P F+ YVNKWKD+ Sbjct: 567 EKYYNKISNTLEKRTKEIVNKMLLEEGVLRRSTRVRAQPKDNPSMAFLKYVNKWKDN 623 >gb|PKI60279.1| hypothetical protein CRG98_019334 [Punica granatum] Length = 109 Score = 65.1 bits (157), Expect = 5e-11 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKDD 165 +K+Y RI T LQKR+K++A K +E++ +RRSTRVRA PR P F+ YVNKWK++ Sbjct: 53 EKYYTRICTELQKRSKELADKIAMEEAVVRRSTRVRAPPRDNPANAFLRYVNKWKEE 109 >ref|XP_020573624.1| DDT domain-containing protein DDB_G0282237 isoform X2 [Phalaenopsis equestris] Length = 698 Score = 68.9 bits (167), Expect = 6e-11 Identities = 32/56 (57%), Positives = 45/56 (80%), Gaps = 2/56 (3%) Frame = +1 Query: 1 DKHYHRISTALQKRTKKVAQKALLEDSELRRSTRVRAKPRAKP--PFITYVNKWKD 162 +K+Y +ISTALQKR+K +AQK L+++SELRRSTRV++ PR P F Y+N+WK+ Sbjct: 613 EKYYVKISTALQKRSKDIAQKILIDESELRRSTRVKSLPRCSPAMTFHKYINRWKE 668