BLASTX nr result
ID: Ophiopogon25_contig00026809
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00026809 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POE85324.1| putative pentatricopeptide repeat-containing prot... 84 1e-16 gb|POE71649.1| putative pentatricopeptide repeat-containing prot... 84 4e-16 ref|XP_023872853.1| putative pentatricopeptide repeat-containing... 84 4e-16 ref|XP_009382022.1| PREDICTED: putative pentatricopeptide repeat... 82 1e-15 ref|XP_020700000.1| putative pentatricopeptide repeat-containing... 82 2e-15 ref|XP_008376675.1| PREDICTED: putative pentatricopeptide repeat... 81 3e-15 gb|KYP35746.1| Putative pentatricopeptide repeat-containing prot... 81 4e-15 ref|XP_020206053.1| putative pentatricopeptide repeat-containing... 81 4e-15 ref|XP_008800173.1| PREDICTED: putative pentatricopeptide repeat... 81 4e-15 ref|XP_015973358.1| putative pentatricopeptide repeat-containing... 80 7e-15 ref|XP_021827003.1| putative pentatricopeptide repeat-containing... 80 1e-14 ref|XP_007219220.2| putative pentatricopeptide repeat-containing... 80 1e-14 ref|XP_008234802.1| PREDICTED: putative pentatricopeptide repeat... 79 1e-14 ref|XP_019053823.1| PREDICTED: putative pentatricopeptide repeat... 79 2e-14 ref|XP_010933339.1| PREDICTED: putative pentatricopeptide repeat... 79 2e-14 ref|XP_007152087.1| hypothetical protein PHAVU_004G101000g [Phas... 79 2e-14 gb|OIV89579.1| hypothetical protein TanjilG_18747 [Lupinus angus... 78 3e-14 gb|PKA53994.1| Putative pentatricopeptide repeat-containing prot... 78 3e-14 ref|XP_016167562.1| putative pentatricopeptide repeat-containing... 78 3e-14 ref|XP_019434332.1| PREDICTED: putative pentatricopeptide repeat... 78 3e-14 >gb|POE85324.1| putative pentatricopeptide repeat-containing protein [Quercus suber] Length = 308 Score = 83.6 bits (205), Expect = 1e-16 Identities = 44/76 (57%), Positives = 59/76 (77%), Gaps = 4/76 (5%) Frame = +3 Query: 177 LPTLKSLHSQL---RPI-TDPSITIKLMRAYSACGLPSLAGNLFDETPHRDRNIVFFNVM 344 + TLK LHS++ +P+ ++PSI IKLMRAY+ACG P + ++FDE P ++N+VFFNVM Sbjct: 51 IKTLKKLHSKIIVDQPLCSNPSIGIKLMRAYAACGEPGITRHVFDEIP--EKNVVFFNVM 108 Query: 345 IRSYVNNRLYPQALLL 392 IRSYVNN LY ALL+ Sbjct: 109 IRSYVNNHLYHDALLV 124 >gb|POE71649.1| putative pentatricopeptide repeat-containing protein [Quercus suber] Length = 458 Score = 83.6 bits (205), Expect = 4e-16 Identities = 44/76 (57%), Positives = 59/76 (77%), Gaps = 4/76 (5%) Frame = +3 Query: 177 LPTLKSLHSQL---RPI-TDPSITIKLMRAYSACGLPSLAGNLFDETPHRDRNIVFFNVM 344 + TLK LHS++ +P+ ++PSI IKLMRAY+ACG P + ++FDE P ++N+VFFNVM Sbjct: 51 IKTLKKLHSKIIVDQPLCSNPSIGIKLMRAYAACGEPGITRHVFDEIP--EKNVVFFNVM 108 Query: 345 IRSYVNNRLYPQALLL 392 IRSYVNN LY ALL+ Sbjct: 109 IRSYVNNHLYHDALLV 124 >ref|XP_023872853.1| putative pentatricopeptide repeat-containing protein At3g49142 [Quercus suber] ref|XP_023883404.1| putative pentatricopeptide repeat-containing protein At3g49142 [Quercus suber] Length = 678 Score = 83.6 bits (205), Expect = 4e-16 Identities = 44/76 (57%), Positives = 59/76 (77%), Gaps = 4/76 (5%) Frame = +3 Query: 177 LPTLKSLHSQL---RPI-TDPSITIKLMRAYSACGLPSLAGNLFDETPHRDRNIVFFNVM 344 + TLK LHS++ +P+ ++PSI IKLMRAY+ACG P + ++FDE P ++N+VFFNVM Sbjct: 51 IKTLKKLHSKIIVDQPLCSNPSIGIKLMRAYAACGEPGITRHVFDEIP--EKNVVFFNVM 108 Query: 345 IRSYVNNRLYPQALLL 392 IRSYVNN LY ALL+ Sbjct: 109 IRSYVNNHLYHDALLV 124 >ref|XP_009382022.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Musa acuminata subsp. malaccensis] Length = 712 Score = 82.4 bits (202), Expect = 1e-15 Identities = 46/89 (51%), Positives = 62/89 (69%), Gaps = 4/89 (4%) Frame = +3 Query: 138 LLQSIDQCRTPSSLPTLKSLHSQL----RPITDPSITIKLMRAYSACGLPSLAGNLFDET 305 L+Q++D CR+P TL+SLHS+L R ++DP++ IKLMRA ++CG P A +FD Sbjct: 65 LIQALDDCRSPR---TLRSLHSRLLHRPRLLSDPAVQIKLMRALASCGDPHGARRVFDGA 121 Query: 306 PHRDRNIVFFNVMIRSYVNNRLYPQALLL 392 PH +N VFFNVMIRSYVN+ L+ A L Sbjct: 122 PH--KNAVFFNVMIRSYVNHGLHGHAFRL 148 >ref|XP_020700000.1| putative pentatricopeptide repeat-containing protein At3g49142 [Dendrobium catenatum] ref|XP_020700001.1| putative pentatricopeptide repeat-containing protein At3g49142 [Dendrobium catenatum] ref|XP_020700002.1| putative pentatricopeptide repeat-containing protein At3g49142 [Dendrobium catenatum] gb|PKU85096.1| Putative pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 667 Score = 81.6 bits (200), Expect = 2e-15 Identities = 46/89 (51%), Positives = 67/89 (75%), Gaps = 4/89 (4%) Frame = +3 Query: 138 LLQSIDQCRTPSSLPTLKSLHSQL---RPIT-DPSITIKLMRAYSACGLPSLAGNLFDET 305 LL+S+D+CR +L L++LH+++ R +T +PS+ +KLMRAY+ CG + A ++FDE+ Sbjct: 28 LLRSVDECR---NLFALQNLHAEVVGRRHLTSNPSVAVKLMRAYATCGDTTSARHVFDES 84 Query: 306 PHRDRNIVFFNVMIRSYVNNRLYPQALLL 392 P +RN+VFFNVMIRSYV + LY ALLL Sbjct: 85 P--ERNVVFFNVMIRSYVGHGLYGDALLL 111 >ref|XP_008376675.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Malus domestica] Length = 678 Score = 81.3 bits (199), Expect = 3e-15 Identities = 43/76 (56%), Positives = 55/76 (72%), Gaps = 4/76 (5%) Frame = +3 Query: 177 LPTLKSLHSQL----RPITDPSITIKLMRAYSACGLPSLAGNLFDETPHRDRNIVFFNVM 344 + TLK LHS + +D S+ IKLMRAY+ACG P +A ++FDE P ++N+VFFNVM Sbjct: 51 IKTLKKLHSSILVNQNLHSDASLGIKLMRAYAACGEPGIARHIFDEIP--EKNVVFFNVM 108 Query: 345 IRSYVNNRLYPQALLL 392 IRSYVNN LY ALL+ Sbjct: 109 IRSYVNNHLYHDALLV 124 >gb|KYP35746.1| Putative pentatricopeptide repeat-containing protein At3g49140 family [Cajanus cajan] Length = 554 Score = 80.9 bits (198), Expect = 4e-15 Identities = 46/88 (52%), Positives = 62/88 (70%), Gaps = 3/88 (3%) Frame = +3 Query: 135 LLLQSIDQCRTPSSLPTLKSLHSQLRPIT---DPSITIKLMRAYSACGLPSLAGNLFDET 305 LL +++DQ + TLK++HS++ + +PS+ IKLMRAY+ACG P LA +FDE Sbjct: 37 LLGKALDQY---PDIKTLKNVHSKVFNLNFHENPSLGIKLMRAYAACGEPGLARKVFDEI 93 Query: 306 PHRDRNIVFFNVMIRSYVNNRLYPQALL 389 P +RN+VF+NVMIRSYVNN Y ALL Sbjct: 94 P--ERNVVFYNVMIRSYVNNHRYNDALL 119 >ref|XP_020206053.1| putative pentatricopeptide repeat-containing protein At3g49142 [Cajanus cajan] Length = 673 Score = 80.9 bits (198), Expect = 4e-15 Identities = 46/88 (52%), Positives = 62/88 (70%), Gaps = 3/88 (3%) Frame = +3 Query: 135 LLLQSIDQCRTPSSLPTLKSLHSQLRPIT---DPSITIKLMRAYSACGLPSLAGNLFDET 305 LL +++DQ + TLK++HS++ + +PS+ IKLMRAY+ACG P LA +FDE Sbjct: 37 LLGKALDQY---PDIKTLKNVHSKVFNLNFHENPSLGIKLMRAYAACGEPGLARKVFDEI 93 Query: 306 PHRDRNIVFFNVMIRSYVNNRLYPQALL 389 P +RN+VF+NVMIRSYVNN Y ALL Sbjct: 94 P--ERNVVFYNVMIRSYVNNHRYNDALL 119 >ref|XP_008800173.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Phoenix dactylifera] Length = 688 Score = 80.9 bits (198), Expect = 4e-15 Identities = 46/99 (46%), Positives = 68/99 (68%), Gaps = 3/99 (3%) Frame = +3 Query: 105 PQLPANSHSLLLLQSIDQCRTPSSLPTLKSLHSQLRP---ITDPSITIKLMRAYSACGLP 275 P+L ++ +L+ L +D+C++P SLP+L+ LHS+L + PS+ IKLMRAY+ACG P Sbjct: 38 PELTDDAAALVHL--LDECQSPRSLPSLRDLHSRLLDRSLASHPSVQIKLMRAYAACGDP 95 Query: 276 SLAGNLFDETPHRDRNIVFFNVMIRSYVNNRLYPQALLL 392 + A +FD + +FFNVMIRSYV + L+ +ALLL Sbjct: 96 ARARRVFDGA--SAKTTIFFNVMIRSYVTHGLHREALLL 132 >ref|XP_015973358.1| putative pentatricopeptide repeat-containing protein At3g49142 isoform X1 [Arachis duranensis] Length = 668 Score = 80.1 bits (196), Expect = 7e-15 Identities = 48/99 (48%), Positives = 67/99 (67%), Gaps = 3/99 (3%) Frame = +3 Query: 99 NSPQLPANSHSLLLLQSIDQCRTPSSLPTLKSLHSQLRPIT---DPSITIKLMRAYSACG 269 +SPQ P + LL +++DQ + TLKS+HS++ ++ +PS+ IKLMRAY+ACG Sbjct: 21 SSPQTPF-FYEELLGKALDQY---PDIKTLKSVHSKIYYLSFHDNPSLGIKLMRAYAACG 76 Query: 270 LPSLAGNLFDETPHRDRNIVFFNVMIRSYVNNRLYPQAL 386 P A +FDE P +RN+VF+NVMIRSYVNN + AL Sbjct: 77 EPLFARKVFDEIP--ERNVVFYNVMIRSYVNNHWFDDAL 113 >ref|XP_021827003.1| putative pentatricopeptide repeat-containing protein At3g49142 [Prunus avium] Length = 678 Score = 79.7 bits (195), Expect = 1e-14 Identities = 43/74 (58%), Positives = 53/74 (71%), Gaps = 4/74 (5%) Frame = +3 Query: 183 TLKSLHSQL----RPITDPSITIKLMRAYSACGLPSLAGNLFDETPHRDRNIVFFNVMIR 350 TLK LHS + R +D S+ IKLMRAY+ACG P + +LFD P ++N+VFFNVMIR Sbjct: 53 TLKELHSSIVVNQRLRSDASLGIKLMRAYAACGEPRITRHLFDRIP--EKNVVFFNVMIR 110 Query: 351 SYVNNRLYPQALLL 392 SYVNN LY ALL+ Sbjct: 111 SYVNNHLYHDALLV 124 >ref|XP_007219220.2| putative pentatricopeptide repeat-containing protein At3g49142 [Prunus persica] gb|ONI25472.1| hypothetical protein PRUPE_2G305300 [Prunus persica] Length = 678 Score = 79.7 bits (195), Expect = 1e-14 Identities = 43/74 (58%), Positives = 53/74 (71%), Gaps = 4/74 (5%) Frame = +3 Query: 183 TLKSLHSQL----RPITDPSITIKLMRAYSACGLPSLAGNLFDETPHRDRNIVFFNVMIR 350 TLK LHS + R +D S+ IKLMRAY+ACG P + +LFD P ++N+VFFNVMIR Sbjct: 53 TLKELHSSIVVDQRLRSDASLGIKLMRAYAACGEPRITRHLFDRIP--EKNVVFFNVMIR 110 Query: 351 SYVNNRLYPQALLL 392 SYVNN LY ALL+ Sbjct: 111 SYVNNHLYHDALLV 124 >ref|XP_008234802.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Prunus mume] Length = 671 Score = 79.3 bits (194), Expect = 1e-14 Identities = 48/100 (48%), Positives = 61/100 (61%), Gaps = 4/100 (4%) Frame = +3 Query: 105 PQLPANSHSLLLLQSIDQCRTPSSLPTLKSLHSQL----RPITDPSITIKLMRAYSACGL 272 P L A +L Q D + TLK LH+ + R +D S+ IKLMRAY+ACG Sbjct: 35 PSLAAQVFGKILDQDPD-------IKTLKELHASIAVNQRLRSDASLGIKLMRAYAACGE 87 Query: 273 PSLAGNLFDETPHRDRNIVFFNVMIRSYVNNRLYPQALLL 392 P + +LFD P ++N+VFFNVMIRSYVNN LY ALL+ Sbjct: 88 PRITRHLFDRIP--EKNVVFFNVMIRSYVNNNLYHDALLV 125 >ref|XP_019053823.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Nelumbo nucifera] Length = 680 Score = 79.0 bits (193), Expect = 2e-14 Identities = 41/73 (56%), Positives = 53/73 (72%), Gaps = 4/73 (5%) Frame = +3 Query: 186 LKSLHSQLRPITD----PSITIKLMRAYSACGLPSLAGNLFDETPHRDRNIVFFNVMIRS 353 LK LHS++ D PS+ IKLMRAY+ACG P+ ++F+E PH +NI+FFNVMIRS Sbjct: 56 LKKLHSKIIVHQDIRLNPSLGIKLMRAYAACGEPTFTRHVFEEIPH--KNIIFFNVMIRS 113 Query: 354 YVNNRLYPQALLL 392 YVNN +Y ALL+ Sbjct: 114 YVNNHMYRDALLI 126 >ref|XP_010933339.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Elaeis guineensis] Length = 690 Score = 79.0 bits (193), Expect = 2e-14 Identities = 43/88 (48%), Positives = 60/88 (68%), Gaps = 3/88 (3%) Frame = +3 Query: 138 LLQSIDQCRTPSSLPTLKSLHSQLRP---ITDPSITIKLMRAYSACGLPSLAGNLFDETP 308 L++ +D+C++P SLP L+ LHS+L + PS+ IKLMRAY+ACG P+ A +FD Sbjct: 49 LVRVLDECQSPHSLPALRDLHSRLLDRGVASHPSVQIKLMRAYAACGDPARARRVFDGA- 107 Query: 309 HRDRNIVFFNVMIRSYVNNRLYPQALLL 392 +FFNVMIRSYV + L+ +ALLL Sbjct: 108 -SANATIFFNVMIRSYVTHGLHREALLL 134 >ref|XP_007152087.1| hypothetical protein PHAVU_004G101000g [Phaseolus vulgaris] gb|ESW24081.1| hypothetical protein PHAVU_004G101000g [Phaseolus vulgaris] Length = 673 Score = 78.6 bits (192), Expect = 2e-14 Identities = 44/89 (49%), Positives = 63/89 (70%), Gaps = 3/89 (3%) Frame = +3 Query: 135 LLLQSIDQCRTPSSLPTLKSLHSQLRPIT---DPSITIKLMRAYSACGLPSLAGNLFDET 305 LL +++DQ + TLK++HS++ ++ +PS+ IKLMRAY+ACG P LA +FD Sbjct: 37 LLGKALDQ---NPDIKTLKNVHSKVFNLSFHENPSLGIKLMRAYAACGEPGLARKVFDGI 93 Query: 306 PHRDRNIVFFNVMIRSYVNNRLYPQALLL 392 P +RN++F+NVMIRSYVNN Y ALL+ Sbjct: 94 P--ERNVIFYNVMIRSYVNNHWYNDALLV 120 >gb|OIV89579.1| hypothetical protein TanjilG_18747 [Lupinus angustifolius] Length = 403 Score = 78.2 bits (191), Expect = 3e-14 Identities = 47/98 (47%), Positives = 66/98 (67%), Gaps = 3/98 (3%) Frame = +3 Query: 102 SPQLPANSHSLLLLQSIDQCRTPSSLPTLKSLHSQLRPIT---DPSITIKLMRAYSACGL 272 +PQ P + LL +++DQ + TLK++HS++ ++ + S+ IKLMRAY+ACG Sbjct: 27 NPQNPVLAEQLLG-KALDQ---HPDIKTLKNVHSKIYYLSFHENTSLGIKLMRAYAACGK 82 Query: 273 PSLAGNLFDETPHRDRNIVFFNVMIRSYVNNRLYPQAL 386 P LA +FDE P +RN+V +NVMIRSYVNN LY AL Sbjct: 83 PGLARKVFDEIP--ERNVVVYNVMIRSYVNNHLYNNAL 118 >gb|PKA53994.1| Putative pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 667 Score = 78.2 bits (191), Expect = 3e-14 Identities = 46/86 (53%), Positives = 58/86 (67%), Gaps = 1/86 (1%) Frame = +3 Query: 138 LLQSIDQCRTPSSLPTLKSLHSQLRPI-TDPSITIKLMRAYSACGLPSLAGNLFDETPHR 314 LL+S+DQCR+ S+L L + RP+ +DP+ IKLMRAY+ CG P A LFDE+ Sbjct: 28 LLRSVDQCRSLSALQKLHFEVASRRPLASDPAAAIKLMRAYALCGDPVGARRLFDES--S 85 Query: 315 DRNIVFFNVMIRSYVNNRLYPQALLL 392 +RN+VFFNVMIRSYV N AL L Sbjct: 86 ERNVVFFNVMIRSYVANGRSHDALFL 111 >ref|XP_016167562.1| putative pentatricopeptide repeat-containing protein At3g49142 isoform X1 [Arachis ipaensis] Length = 668 Score = 78.2 bits (191), Expect = 3e-14 Identities = 47/99 (47%), Positives = 66/99 (66%), Gaps = 3/99 (3%) Frame = +3 Query: 99 NSPQLPANSHSLLLLQSIDQCRTPSSLPTLKSLHSQLRPIT---DPSITIKLMRAYSACG 269 +SPQ P + LL +++DQ + TLKS+HS++ + +PS+ IKL+RAY+ACG Sbjct: 21 SSPQTPF-FYEELLGKALDQY---PDIKTLKSVHSKIYYLNFHDNPSLGIKLIRAYAACG 76 Query: 270 LPSLAGNLFDETPHRDRNIVFFNVMIRSYVNNRLYPQAL 386 P A +FDE P +RN+VF+NVMIRSYVNN + AL Sbjct: 77 EPLFARKVFDEIP--ERNVVFYNVMIRSYVNNHWFDDAL 113 >ref|XP_019434332.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Lupinus angustifolius] Length = 673 Score = 78.2 bits (191), Expect = 3e-14 Identities = 47/98 (47%), Positives = 66/98 (67%), Gaps = 3/98 (3%) Frame = +3 Query: 102 SPQLPANSHSLLLLQSIDQCRTPSSLPTLKSLHSQLRPIT---DPSITIKLMRAYSACGL 272 +PQ P + LL +++DQ + TLK++HS++ ++ + S+ IKLMRAY+ACG Sbjct: 27 NPQNPVLAEQLLG-KALDQ---HPDIKTLKNVHSKIYYLSFHENTSLGIKLMRAYAACGK 82 Query: 273 PSLAGNLFDETPHRDRNIVFFNVMIRSYVNNRLYPQAL 386 P LA +FDE P +RN+V +NVMIRSYVNN LY AL Sbjct: 83 PGLARKVFDEIP--ERNVVVYNVMIRSYVNNHLYNNAL 118