BLASTX nr result
ID: Ophiopogon25_contig00026561
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00026561 (643 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259829.1| pentatricopeptide repeat-containing protein ... 64 4e-08 >ref|XP_020259829.1| pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Asparagus officinalis] ref|XP_020259830.1| pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Asparagus officinalis] ref|XP_020259831.1| pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Asparagus officinalis] ref|XP_020259832.1| pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Asparagus officinalis] ref|XP_020259833.1| pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Asparagus officinalis] gb|ONK70751.1| uncharacterized protein A4U43_C04F1150 [Asparagus officinalis] Length = 1022 Score = 63.5 bits (153), Expect = 4e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 643 EDKLHPSAIDIYQMLKDLNIEMKEEGYVAEPDWLMLDE 530 EDKLHP A+DIY+MLKDL IEMKEEGYV E D LML+E Sbjct: 984 EDKLHPRAVDIYEMLKDLGIEMKEEGYVPELDELMLNE 1021