BLASTX nr result
ID: Ophiopogon25_contig00026522
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00026522 (352 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019053451.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 53 1e-05 >ref|XP_019053451.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform X2 [Nelumbo nucifera] Length = 219 Score = 52.8 bits (125), Expect = 1e-05 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +2 Query: 176 YIVLFQSREVNAASSSLQGITSL-SRVELDSSISDSYRAPPRPLP 307 Y LFQ EV+A SS+QG TSL S LD+S+ D YR+PPRPLP Sbjct: 39 YTALFQRGEVHALPSSIQGATSLTSSASLDNSLCDMYRSPPRPLP 83