BLASTX nr result
ID: Ophiopogon25_contig00024624
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00024624 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009392295.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-07 ref|XP_010936694.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 gb|OAY68833.1| Pentatricopeptide repeat-containing protein [Anan... 55 9e-06 ref|XP_020083063.1| pentatricopeptide repeat-containing protein ... 55 9e-06 >ref|XP_009392295.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 710 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -1 Query: 439 VSGLLGGGMVGEAKSMYDSMQSLGFSPSESVRVAIMASQSFAQHKLPVTR*G 284 +SGLL GG++ +AK +YD MQS G +PSE +RVA++A+QS + K P R G Sbjct: 656 ISGLLAGGLLEDAKRIYDCMQSQGLAPSEPIRVALLAAQSIRRQKSPTRRGG 707 >ref|XP_010936694.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06920 [Elaeis guineensis] Length = 705 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 439 VSGLLGGGMVGEAKSMYDSMQSLGFSPSESVRVAIMASQSFAQHK 305 VSGLL GG+V +AK +Y+SM++ GFSPSE RVA+MA++S + K Sbjct: 653 VSGLLAGGLVEDAKRIYNSMEARGFSPSEPTRVALMAAKSIPRQK 697 >gb|OAY68833.1| Pentatricopeptide repeat-containing protein [Ananas comosus] Length = 704 Score = 54.7 bits (130), Expect = 9e-06 Identities = 28/50 (56%), Positives = 38/50 (76%) Frame = -1 Query: 439 VSGLLGGGMVGEAKSMYDSMQSLGFSPSESVRVAIMASQSFAQHKLPVTR 290 +SGLL GG V +AK M+ MQ+ GF+PSESVRVA+MA+QS + + P +R Sbjct: 653 ISGLLAGGFVQDAKRMHGLMQARGFAPSESVRVALMAAQSIPRPR-PASR 701 >ref|XP_020083063.1| pentatricopeptide repeat-containing protein At1g64100 [Ananas comosus] Length = 705 Score = 54.7 bits (130), Expect = 9e-06 Identities = 28/50 (56%), Positives = 38/50 (76%) Frame = -1 Query: 439 VSGLLGGGMVGEAKSMYDSMQSLGFSPSESVRVAIMASQSFAQHKLPVTR 290 +SGLL GG V +AK M+ MQ+ GF+PSESVRVA+MA+QS + + P +R Sbjct: 654 ISGLLAGGFVQDAKRMHGLMQARGFAPSESVRVALMAAQSIPRPR-PASR 702