BLASTX nr result
ID: Ophiopogon25_contig00024575
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00024575 (444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267823.1| cinnamoyl-CoA reductase-like SNL6 [Asparagus... 56 2e-06 gb|ONK68544.1| uncharacterized protein A4U43_C05F13070 [Asparagu... 56 3e-06 >ref|XP_020267823.1| cinnamoyl-CoA reductase-like SNL6 [Asparagus officinalis] Length = 219 Score = 55.8 bits (133), Expect = 2e-06 Identities = 29/59 (49%), Positives = 32/59 (54%) Frame = +3 Query: 3 IRRVEDVAELERQLGIPNRRTPIASSSDRPPTWFEXXXXXXXXXXXXXXXXXYDIYSIP 179 +RR EDVAELERQL IPNR IA SD+ PTWFE + YSIP Sbjct: 161 VRRAEDVAELERQLRIPNRTASIAQESDQLPTWFELSKRKVSRLMSSSRRCLHGTYSIP 219 >gb|ONK68544.1| uncharacterized protein A4U43_C05F13070 [Asparagus officinalis] Length = 307 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/59 (49%), Positives = 32/59 (54%) Frame = +3 Query: 3 IRRVEDVAELERQLGIPNRRTPIASSSDRPPTWFEXXXXXXXXXXXXXXXXXYDIYSIP 179 +RR EDVAELERQL IPNR IA SD+ PTWFE + YSIP Sbjct: 249 VRRAEDVAELERQLRIPNRTASIAQESDQLPTWFELSKRKVSRLMSSSRRCLHGTYSIP 307