BLASTX nr result
ID: Ophiopogon25_contig00024545
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00024545 (1004 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252248.1| uncharacterized protein LOC109829595 [Aspara... 61 2e-06 >ref|XP_020252248.1| uncharacterized protein LOC109829595 [Asparagus officinalis] Length = 942 Score = 60.8 bits (146), Expect = 2e-06 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 168 KRGLMQGAPLSPLLFVLAADVFAKMLNLAAQNGVLSGLSPNN 43 KRG+ QG PLSPLLFVLAAD F KMLNLA ++ + GL PNN Sbjct: 450 KRGVRQGDPLSPLLFVLAADSFTKMLNLAVESHFIEGLGPNN 491