BLASTX nr result
ID: Ophiopogon25_contig00024291
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00024291 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA56317.1| hypothetical protein AXF42_Ash011247 [Apostasia s... 52 9e-07 gb|PKA52043.1| hypothetical protein AXF42_Ash013980 [Apostasia s... 52 9e-07 ref|XP_020243251.1| uncharacterized protein LOC109821475 [Aspara... 55 1e-06 gb|PKA59365.1| hypothetical protein AXF42_Ash001459 [Apostasia s... 51 3e-06 >gb|PKA56317.1| hypothetical protein AXF42_Ash011247 [Apostasia shenzhenica] Length = 55 Score = 52.4 bits (124), Expect = 9e-07 Identities = 22/50 (44%), Positives = 35/50 (70%) Frame = +2 Query: 74 QQPVALIGRSMKVLKDRTIPWVLVLWNKNAPGAAT*EREDVIRSGYPDLF 223 ++P+ ++ R +VL++RTIP V +LW + AT ERED +R+ YP+LF Sbjct: 5 EKPIGILDRKDQVLRNRTIPLVKILWQHHTSEEATWEREDEVRNNYPELF 54 >gb|PKA52043.1| hypothetical protein AXF42_Ash013980 [Apostasia shenzhenica] Length = 55 Score = 52.4 bits (124), Expect = 9e-07 Identities = 22/50 (44%), Positives = 35/50 (70%) Frame = +2 Query: 74 QQPVALIGRSMKVLKDRTIPWVLVLWNKNAPGAAT*EREDVIRSGYPDLF 223 ++P+ ++ R +VL++RTIP V +LW N AT ER+D +R+ YP+LF Sbjct: 5 EKPIGILDRKDQVLRNRTIPLVKILWQHNTSDEATWERKDEVRNKYPELF 54 >ref|XP_020243251.1| uncharacterized protein LOC109821475 [Asparagus officinalis] Length = 219 Score = 55.5 bits (132), Expect = 1e-06 Identities = 28/55 (50%), Positives = 36/55 (65%) Frame = +2 Query: 65 SSHQQPVALIGRSMKVLKDRTIPWVLVLWNKNAPGAAT*EREDVIRSGYPDLFRT 229 S ++P+ ++ + KVLK+RTI VLV W + G AT ERED IR YPDLF T Sbjct: 162 SYEERPMKILDKQEKVLKNRTISLVLVSWGHHGLGKATWEREDDIRQRYPDLFTT 216 >gb|PKA59365.1| hypothetical protein AXF42_Ash001459 [Apostasia shenzhenica] Length = 55 Score = 51.2 bits (121), Expect = 3e-06 Identities = 23/50 (46%), Positives = 34/50 (68%) Frame = +2 Query: 74 QQPVALIGRSMKVLKDRTIPWVLVLWNKNAPGAAT*EREDVIRSGYPDLF 223 ++P+ ++ R +VL +RTIP V +LW + AT ERED +R+ YPDLF Sbjct: 5 EKPIEILDRKDQVLCNRTIPLVKILWQHHTSDEATWEREDEVRNKYPDLF 54