BLASTX nr result
ID: Ophiopogon25_contig00024258
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00024258 (421 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63191.1| hypothetical protein 20.t00043 [Asparagus officin... 50 2e-08 gb|ONK65039.1| uncharacterized protein A4U43_C07F32850 [Asparagu... 54 1e-06 >gb|ABD63191.1| hypothetical protein 20.t00043 [Asparagus officinalis] Length = 316 Score = 49.7 bits (117), Expect(2) = 2e-08 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = +3 Query: 156 MVTTAGKTVFSEEMVVLQFDKVAVGTSVESLVIEFDQV*RKHSL 287 M T G+TV S EMVV QFD+V V T+VESL+IEFDQ K L Sbjct: 1 MATIVGETVSSTEMVVGQFDEVVVETTVESLIIEFDQAKYKEYL 44 Score = 36.2 bits (82), Expect(2) = 2e-08 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +1 Query: 265 KYEENIPSISSKDATMRKCRKMVRDAKPRQARTLGSQRPARALTGGFHSP 414 KY+E + + SS RKC ++VR +P+ A + RA+ GG SP Sbjct: 39 KYKEYLSTSSSNGNASRKCHRVVRVTRPQVAEASMPEDSTRAMAGGSISP 88 >gb|ONK65039.1| uncharacterized protein A4U43_C07F32850 [Asparagus officinalis] Length = 113 Score = 53.9 bits (128), Expect = 1e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +3 Query: 156 MVTTAGKTVFSEEMVVLQFDKVAVGTSVESLVIEFDQ 266 M TT G+ V S EMVV QFD+VAVGT+VESL IEFDQ Sbjct: 1 MATTVGEVVSSNEMVVAQFDEVAVGTTVESLEIEFDQ 37