BLASTX nr result
ID: Ophiopogon25_contig00024101
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00024101 (682 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008776846.1| PREDICTED: LOW QUALITY PROTEIN: nuclear pore... 59 2e-06 >ref|XP_008776846.1| PREDICTED: LOW QUALITY PROTEIN: nuclear pore complex protein NUP205 [Phoenix dactylifera] Length = 1866 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 145 KCYILDFRGAIVPRQAVVFRERLSLSHCLALSVL 44 +CY+LDFRGAIV R+AVV RERLSLSHCL LSVL Sbjct: 192 ECYVLDFRGAIVQRRAVVSRERLSLSHCLVLSVL 225