BLASTX nr result
ID: Ophiopogon25_contig00023861
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00023861 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010262856.1| PREDICTED: inositol 3-kinase-like [Nelumbo n... 48 7e-07 >ref|XP_010262856.1| PREDICTED: inositol 3-kinase-like [Nelumbo nucifera] Length = 385 Score = 47.8 bits (112), Expect(2) = 7e-07 Identities = 26/51 (50%), Positives = 32/51 (62%), Gaps = 2/51 (3%) Frame = +1 Query: 154 LDICRTIVTDVQSFMCAFDPLDGPICLVPFKINPL--L*SRIGFLKELAEE 300 LDICR + D+Q+ + FDPLDG + LV K + L RIGFLK AEE Sbjct: 143 LDICRVVFVDIQALIRVFDPLDGTVKLVELKDSGFFHLLPRIGFLKASAEE 193 Score = 33.1 bits (74), Expect(2) = 7e-07 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 5/44 (11%) Frame = +3 Query: 3 HSHFVEDADVTI--DCVLKHVYTCDPISP---PRSSLKFWQSFG 119 H+HF D D + D +L+ ++ CDPISP P S F + G Sbjct: 86 HAHFFSDRDSSRHQDRILRRIHACDPISPSDLPESQFDFGLAVG 129