BLASTX nr result
ID: Ophiopogon25_contig00023373
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00023373 (555 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65896.1| uncharacterized protein A4U43_C06F2090 [Asparagus... 54 5e-06 >gb|ONK65896.1| uncharacterized protein A4U43_C06F2090 [Asparagus officinalis] Length = 141 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -2 Query: 554 SEKVKMELFRKGYTNLLIQMGRGSYIPSKVS 462 S+KVK ELFRKGYT+L+IQMGRGSY PSK++ Sbjct: 32 SDKVKEELFRKGYTDLVIQMGRGSYFPSKIT 62