BLASTX nr result
ID: Ophiopogon25_contig00023174
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00023174 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253030.1| omega-hydroxypalmitate O-feruloyl transferas... 60 1e-07 >ref|XP_020253030.1| omega-hydroxypalmitate O-feruloyl transferase-like [Asparagus officinalis] gb|ONK77370.1| uncharacterized protein A4U43_C02F5820 [Asparagus officinalis] Length = 450 Score = 60.1 bits (144), Expect = 1e-07 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -1 Query: 119 MEATFLLTQQDIVKEVLVTLLVSPRYPTPTEIVFLSNID 3 ME TFLLT QD+VKEV VTL VSP +PTPTE+VFLSNID Sbjct: 1 METTFLLTSQDVVKEVPVTL-VSPVHPTPTEVVFLSNID 38