BLASTX nr result
ID: Ophiopogon25_contig00022994
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00022994 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK71061.1| uncharacterized protein A4U43_C04F4300 [Asparagus... 63 6e-09 ref|XP_020260144.1| nucleolar complex protein 4 homolog isoform ... 63 6e-09 ref|XP_020260143.1| nucleolar complex protein 4 homolog isoform ... 63 6e-09 ref|XP_020260142.1| nucleolar complex protein 4 homolog isoform ... 63 6e-09 ref|XP_009112419.1| PREDICTED: uncharacterized protein C1604.06c... 56 2e-06 ref|XP_020096315.1| nucleolar complex protein 4 homolog [Ananas ... 55 4e-06 gb|OAY65227.1| Nucleolar complex protein [Ananas comosus] 54 7e-06 gb|OAY73704.1| Nucleolar complex protein B [Ananas comosus] 54 7e-06 >gb|ONK71061.1| uncharacterized protein A4U43_C04F4300 [Asparagus officinalis] Length = 578 Score = 63.2 bits (152), Expect = 6e-09 Identities = 38/55 (69%), Positives = 40/55 (72%), Gaps = 6/55 (10%) Frame = +2 Query: 80 LGDQLLSS------IVTLLSVRSPSSPLKFSLEALISFQSFFVPFVPGIPLKSSA 226 LG QLLSS + TLLSV SPSSPLKFSLEALIS QSFFVP V IP K+ A Sbjct: 34 LGSQLLSSRAHINNLPTLLSVLSPSSPLKFSLEALISLQSFFVPLVNEIPSKTLA 88 >ref|XP_020260144.1| nucleolar complex protein 4 homolog isoform X3 [Asparagus officinalis] Length = 628 Score = 63.2 bits (152), Expect = 6e-09 Identities = 38/55 (69%), Positives = 40/55 (72%), Gaps = 6/55 (10%) Frame = +2 Query: 80 LGDQLLSS------IVTLLSVRSPSSPLKFSLEALISFQSFFVPFVPGIPLKSSA 226 LG QLLSS + TLLSV SPSSPLKFSLEALIS QSFFVP V IP K+ A Sbjct: 34 LGSQLLSSRAHINNLPTLLSVLSPSSPLKFSLEALISLQSFFVPLVNEIPSKTLA 88 >ref|XP_020260143.1| nucleolar complex protein 4 homolog isoform X2 [Asparagus officinalis] Length = 628 Score = 63.2 bits (152), Expect = 6e-09 Identities = 38/55 (69%), Positives = 40/55 (72%), Gaps = 6/55 (10%) Frame = +2 Query: 80 LGDQLLSS------IVTLLSVRSPSSPLKFSLEALISFQSFFVPFVPGIPLKSSA 226 LG QLLSS + TLLSV SPSSPLKFSLEALIS QSFFVP V IP K+ A Sbjct: 34 LGSQLLSSRAHINNLPTLLSVLSPSSPLKFSLEALISLQSFFVPLVNEIPSKTLA 88 >ref|XP_020260142.1| nucleolar complex protein 4 homolog isoform X1 [Asparagus officinalis] Length = 629 Score = 63.2 bits (152), Expect = 6e-09 Identities = 38/55 (69%), Positives = 40/55 (72%), Gaps = 6/55 (10%) Frame = +2 Query: 80 LGDQLLSS------IVTLLSVRSPSSPLKFSLEALISFQSFFVPFVPGIPLKSSA 226 LG QLLSS + TLLSV SPSSPLKFSLEALIS QSFFVP V IP K+ A Sbjct: 34 LGSQLLSSRAHINNLPTLLSVLSPSSPLKFSLEALISLQSFFVPLVNEIPSKTLA 88 >ref|XP_009112419.1| PREDICTED: uncharacterized protein C1604.06c-like [Brassica rapa] Length = 597 Score = 55.8 bits (133), Expect = 2e-06 Identities = 33/87 (37%), Positives = 48/87 (55%), Gaps = 1/87 (1%) Frame = +2 Query: 20 KSKSTFYFPLKSLFPLVPSLLGDQL-LSSIVTLLSVRSPSSPLKFSLEALISFQSFFVPF 196 K K + LK L L LL + ++++ LLS SP SP +F +E+L+S QSFF P Sbjct: 8 KQKKKENYTLKDLKSLGSDLLSSRAHINNLPLLLSFISPDSPPQFVVESLLSLQSFFTPL 67 Query: 197 VPGIPLKSSAPYDFISRRHR*KMDDDN 277 +P +P SS+P R + DDD+ Sbjct: 68 LPQLPSSSSSPASSTKRPRSDEQDDDD 94 >ref|XP_020096315.1| nucleolar complex protein 4 homolog [Ananas comosus] Length = 634 Score = 55.1 bits (131), Expect = 4e-06 Identities = 35/72 (48%), Positives = 45/72 (62%), Gaps = 6/72 (8%) Frame = +2 Query: 80 LGDQLLSSIV------TLLSVRSPSSPLKFSLEALISFQSFFVPFVPGIPLKSSAPYDFI 241 L +LLSS+ LLS SPSSPL+F+LE+LIS QSFFVP +P IP SS Sbjct: 38 LAHELLSSLAHVNNLPRLLSFLSPSSPLEFALESLISVQSFFVPLLPEIPAASS------ 91 Query: 242 SRRHR*KMDDDN 277 S R K++D++ Sbjct: 92 SSSSRSKLEDED 103 >gb|OAY65227.1| Nucleolar complex protein [Ananas comosus] Length = 635 Score = 54.3 bits (129), Expect = 7e-06 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 6/55 (10%) Frame = +2 Query: 80 LGDQLLSSIV------TLLSVRSPSSPLKFSLEALISFQSFFVPFVPGIPLKSSA 226 L +LLSS+ LLS SPSSPL+F+LE+LIS QSFFVP +P IP SS+ Sbjct: 38 LAHELLSSLAHVNNLPRLLSFLSPSSPLEFALESLISVQSFFVPLLPEIPAASSS 92 >gb|OAY73704.1| Nucleolar complex protein B [Ananas comosus] Length = 648 Score = 54.3 bits (129), Expect = 7e-06 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 6/55 (10%) Frame = +2 Query: 80 LGDQLLSSIV------TLLSVRSPSSPLKFSLEALISFQSFFVPFVPGIPLKSSA 226 L +LLSS+ LLS SPSSPL+F+LE+LIS QSFFVP +P IP SS+ Sbjct: 38 LAHELLSSLAHVNNLPRLLSFLSPSSPLEFALESLISVQSFFVPLLPEIPAASSS 92