BLASTX nr result
ID: Ophiopogon25_contig00022910
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00022910 (371 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK73941.1| uncharacterized protein A4U43_C03F1160 [Asparagus... 58 2e-07 ref|XP_020277346.1| aldose 1-epimerase [Asparagus officinalis] >... 55 2e-06 >gb|ONK73941.1| uncharacterized protein A4U43_C03F1160 [Asparagus officinalis] Length = 329 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +1 Query: 226 RKRLPVKKVPKAYEIKTGDFSVKVSNFGATILSVVLPDAQ 345 +++L KKV K YEIK GDFS+KVSN GA ILSVVLPD+Q Sbjct: 25 QRKLLEKKVAKVYEIKKGDFSIKVSNLGAVILSVVLPDSQ 64 >ref|XP_020277346.1| aldose 1-epimerase [Asparagus officinalis] gb|ONK60915.1| uncharacterized protein A4U43_C08F24040 [Asparagus officinalis] Length = 362 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 232 RLPVKKVPKAYEIKTGDFSVKVSNFGATILSVVLPDA 342 RL KK +AYEIK G FSVKVSN+GATILSVVLPD+ Sbjct: 27 RLQEKKTAEAYEIKKGKFSVKVSNWGATILSVVLPDS 63