BLASTX nr result
ID: Ophiopogon25_contig00022858
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00022858 (382 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020250187.1| uncharacterized protein LOC109827589 [Aspara... 83 7e-16 gb|ONK80853.1| uncharacterized protein A4U43_C01F22500 [Asparagu... 83 7e-16 >ref|XP_020250187.1| uncharacterized protein LOC109827589 [Asparagus officinalis] Length = 792 Score = 82.8 bits (203), Expect = 7e-16 Identities = 50/125 (40%), Positives = 63/125 (50%) Frame = +3 Query: 6 ESFHMIPPKIAIDEQESRYPLHYPSVPSPQENKIEPQYEQRTHFVSKHLVSEEIRRPIEP 185 E +HM + A DEQ S +P YP+ P ENK E + EQ THF K P Sbjct: 206 EGYHMT--RTASDEQGSHHPPPYPNYGPPLENKFELRNEQITHFAPK------------P 251 Query: 186 YVNSMPYESNGYKMDSVMEGRVHTSQAYXXXXXXXXXXXXXXXXXXXXFQDKPLIQTPPL 365 YV+S +ESN Y+MDS + GRV+ S Y FQDKPLI++PP Sbjct: 252 YVSSASHESNDYRMDSTLPGRVYNSLHYAPLPPHPPIPPPPEPSPPRNFQDKPLIRSPPP 311 Query: 366 LPSPV 380 L SP+ Sbjct: 312 LLSPI 316 >gb|ONK80853.1| uncharacterized protein A4U43_C01F22500 [Asparagus officinalis] Length = 868 Score = 82.8 bits (203), Expect = 7e-16 Identities = 50/125 (40%), Positives = 63/125 (50%) Frame = +3 Query: 6 ESFHMIPPKIAIDEQESRYPLHYPSVPSPQENKIEPQYEQRTHFVSKHLVSEEIRRPIEP 185 E +HM + A DEQ S +P YP+ P ENK E + EQ THF K P Sbjct: 288 EGYHMT--RTASDEQGSHHPPPYPNYGPPLENKFELRNEQITHFAPK------------P 333 Query: 186 YVNSMPYESNGYKMDSVMEGRVHTSQAYXXXXXXXXXXXXXXXXXXXXFQDKPLIQTPPL 365 YV+S +ESN Y+MDS + GRV+ S Y FQDKPLI++PP Sbjct: 334 YVSSASHESNDYRMDSTLPGRVYNSLHYAPLPPHPPIPPPPEPSPPRNFQDKPLIRSPPP 393 Query: 366 LPSPV 380 L SP+ Sbjct: 394 LLSPI 398